|
||||||
|
UniGene Name: biog3_v1.0_unigene15800
Length: 236 nt
 UniGene Fasta
|
|---|
| >biog3_v1.0_unigene15800
T |
|
Ace file of the UniGene biog3_v1.0_unigene15800
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Parent Assembly | Parent UniGene | Reads (related/total) |
|---|---|---|
| SustainPine v2.0 | sp_v2.0_unigene12003 | 2/2 |
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | nitrite reductase [Nicotiana tabacum] | - | - | 0.0 | 74% |
| FL-Next | sp=Ferredoxin--nitrite reductase, chloroplastic; Betula pendula (European white birch) (Betula verrucosa). | - | - | 0.0 | 79% |
| Blast2go | ferredoxin--nitrite reductase | - | - | 0.0 | 86% |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Nitrite reductase (NO-forming). | EC:1.7.2.1 | - | 0.0 | 86% |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Nitrogen metabolism | 00910 | 0.0 | 86% | |
| Blast2go | Ferredoxin--nitrite reductase. | EC:1.7.7.1 | - | 0.0 | 86% |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Nitrogen metabolism | 00910 | 0.0 | 86% | |
| Blast2go | Ferredoxin--nitrate reductase. | EC:1.7.7.2 | - | 0.0 | 86% |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Nitrogen metabolism | 00910 | 0.0 | 86% |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | nitrate assimilation | GO:0042128 | Biological Process | 0.0 | 86% |
| Blast2go | transport | GO:0006810 | Biological Process | 0.0 | 86% |
| Blast2go | response to nitrate | GO:0010167 | Biological Process | 0.0 | 86% |
| Blast2go | electron transport chain | GO:0022900 | Biological Process | 0.0 | 86% |
| Blast2go | nitrite reductase (NO-forming) activity | GO:0050421 | Molecular Function | 0.0 | 86% |
| Blast2go | ferredoxin-nitrite reductase activity | GO:0048307 | Molecular Function | 0.0 | 86% |
| Blast2go | protein binding | GO:0005515 | Molecular Function | 0.0 | 86% |
| Blast2go | heme binding | GO:0020037 | Molecular Function | 0.0 | 86% |
| Blast2go | 4 iron, 4 sulfur cluster binding | GO:0051539 | Molecular Function | 0.0 | 86% |
| Blast2go | ferredoxin-nitrate reductase activity | GO:0047889 | Molecular Function | 0.0 | 86% |
| Blast2go | chloroplast stroma | GO:0009570 | Cellular Component | 0.0 | 86% |
| Blast2go | membrane | GO:0016020 | Cellular Component | 0.0 | 86% |
| Blast2go | apoplast | GO:0048046 | Cellular Component | 0.0 | 86% |
| Blast2go | mitochondrion | GO:0005739 | Cellular Component | 0.0 | 86% |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Nitrite/sulphite reductase iron-sulphur/siroheam-binding site | IPR006066 | - | 0.0 | - |
| Sma3 | Nitrite/sulphite reductase 4Fe-4S domain | IPR006067 | - | 0.0 | - |
| Sma3 | Nitrite/sulphite reductase, hemoprotein beta-component, ferrodoxin-like | IPR005117 | - | 0.0 | - |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: P38500
Fln msg: Distance to subject end: 62 aas, your sequence is shorter than subject: 78 - 583
Fln protein:
L
Protein Length:
79
Fln nts:
T
Fln Alignment:
biogeco3_mira_c11649___KFSPSPPLLVSTLVACTGNQFCGQAIIETKARALKITEELDRTMEVPKPVRMHWTGCPNTCGQVQVADIGFMGC
P38500__________________RFSPEPPILMKGLVACTGNQFCGQAIIETKARALKVTEEVQRQVAVTRPVRMHWTGCPNSCGQVQVADIGFMGC
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
