SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: biogeco3 v1.0

UniGene Name: biog3_v1.0_unigene15542

Length: 291 nt

This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense

UniGene Fasta (sense)

>biog3_v1.0_unigene15542
CGGGAACCGAAGGAATGTTAACTCCAACAAGATTGCTATAATGCAATGTAGAAGAAAATTTGCACCAGTCAAAAGACACAGAACGCTCAGGGGTCCTAGGGGAATTGCAGGTCTTGGCATACAGAATATGGTGTGAAAAATGGGGCATCTTAACTAACTTTTACCCTTTTCTTCTAGTGGCCTTTGCCTTTCTTGCTTTTGTGATACACAATGGCAGCATAGTTGTGGGAGCGAAAGAGGCACATCCAGTGTCTCCCCACTTTGCACAGATTTTGTATTTTGGGCTACATT

Ace file of the UniGene biog3_v1.0_unigene15542 (antisense)

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Parent Assembly	Parent UniGene	Reads (related/total)
SustainPine v2.0	sp_v2.0_unigene1897	4/4

Source	Descriptions	Term	Type	Identity
AutoFact	asparagine-linked glycosylation 10 homolog (yeast, alpha-1,2-glucosyltransferase) [Gallus gallus] emb\|CAG31830.1\| hypothetical protein RCJMB04_11p1 [Gallus gallus]	-	-	30%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	89%
Blast2go	dol-p-glc:glc man c -pp-dol alpha- -glucosyltransferase-like	-	-	65%

Source	ECs	Term	Type	e value	Identity
Blast2go	Transferases, Glycosyltransferases, Hexosyltransferases.	EC:2.4.1.-	-	0.0	65%

Source	KEGGs	Term	Identity
Blast2go	Fructose and mannose metabolism	00051	65%
Blast2go	N-Glycan biosynthesis	00510	65%
Blast2go	Mucin type O-Glycan biosynthesis	00512	65%
Blast2go	Various types of N-glycan biosynthesis	00513	65%
Blast2go	Other types of O-glycan biosynthesis	00514	65%
Blast2go	Biosynthesis of 12-, 14- and 16-membered macrolides	00522	65%
Blast2go	Glycosaminoglycan biosynthesis - keratan sulfate	00533	65%
Blast2go	Lipopolysaccharide biosynthesis	00540	65%
Blast2go	Peptidoglycan biosynthesis	00550	65%
Blast2go	Glycerolipid metabolism	00561	65%
Blast2go	Glycosylphosphatidylinositol(GPI)-anchor biosynthesis	00563	65%
Blast2go	Sphingolipid metabolism	00600	65%
Blast2go	Glycosphingolipid biosynthesis - lacto and neolacto series	00601	65%
Blast2go	Glycosphingolipid biosynthesis - globo series	00603	65%
Blast2go	Glycosphingolipid biosynthesis - ganglio series	00604	65%
Blast2go	Carotenoid biosynthesis	00906	65%
Blast2go	Zeatin biosynthesis	00908	65%
Blast2go	Flavonoid biosynthesis	00941	65%
Blast2go	Anthocyanin biosynthesis	00942	65%
Blast2go	Flavone and flavonol biosynthesis	00944	65%
Blast2go	Stilbenoid, diarylheptanoid and gingerol biosynthesis	00945	65%
Blast2go	Betalain biosynthesis	00965	65%
Blast2go	Biosynthesis of type II polyketide products	01057	65%
Blast2go	Metabolic pathways	01100	65%
Blast2go	Biosynthesis of secondary metabolites	01110	65%

Source	GOs	Term	Type	Identity
Blast2go	transferase activity, transferring hexosyl groups	GO:0016758	Molecular Function	65%
Blast2go	cytoplasmic membrane-bounded vesicle	GO:0016023	Cellular Component	65%
Blast2go	integral to membrane	GO:0016021	Cellular Component	65%

Source	InterPros	Term	Type	e value	Identity
Sma3	Glycosyltransferase, ALG10	IPR007006	-	0.0	-

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: B8LQL5

Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 48 aas, your sequence is shorter than subject: 96 - 379

Fln protein: GTEGMLTPTRLL*CNVEENLHQSKDTERSGVLGELQVLAYRIWCEKWGILTNFYPFLLVAFAFLAFVIHNGSIVVGAKEAHPVSPHFAQILYFGLH

Protein Length: 97

Fln nts: CGGGAACCGAAGGAATGTTAACTCCAACAAGATTGCTATAATGCAATGTAGAAGAAAATTTGCACCAGTCAAAAGACACAGAACGCTCAGGGGTCCTAGGGGAATTGCAGGTCTTGGCATACAGAATATGGTGTGAAAAATGGGGCATCTTAACTAACTTTTACCCTTTTCTTCTAGTGGCCTTTGCCTTTCTTGCTTTTGTGATACACAATGGCAGCATAGTTGTGGGAGCGAAAGAGGCACATCCAGTGTCTCCCCACTTTGCACAGATTTTGTATTTTGGGCTACATT

Fln Alignment:

biogeco3_mira_c11068___EENLHQSKDTERSGVLGELQVLAYRIWCEKWGILTNFYPXXXXXXXXXXXVIHNGSIVVGAKEAHPVSPHFAQILYFGL
B8LQL5__________________EENLHQSKDSECSGVLGELQVLAYRLWCKKWGILTTFYPFLLVAFAFLAFVVYNGSIVVGAKEAHPVSPHFTQILYFGL

SNPs (tot: 4)

Position	A %	C %	G %	T %	Probability
50	25			75	0.996473
51	25		75		0.996473
52		75		25	0.996473
53		75	25		0.996473

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain