|
||||||
|
UniGene Name: biog3_v1.0_unigene14991
Length: 235 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
 UniGene Fasta (sense)
|
|---|
| >biog3_v1.0_unigene14991
A |
|
Ace file of the UniGene biog3_v1.0_unigene14991 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Parent Assembly | Parent UniGene | Reads (related/total) |
|---|---|---|
| SustainPine v2.0 | sp_v2.0_unigene40991 | 2/2 |
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] sp|Q9SY02.1|PP301_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At4g02750 gb|AAD15348.1| hypothetical protein [Arabidopsis thaliana] emb|CAB77760.1| hypothetical protein | - | - | 5.0e-22 | 63% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 85% |
| Blast2go | pentatricopeptide repeat-containing protein at1g11290-like | - | - | 3.53053e-36 | 80% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LQA8
Fln msg: Distance to subject end: 180 aas, your sequence is shorter than subject: 77 - 795
Fln protein:
C
Protein Length:
78
Fln nts:
A
Fln Alignment:
biogeco3_mira_c9380___LVDQGRQYFQCMKSDYGLEPELEHYACLVDLLGRAGHLEEAHDIIKKMPLEPGADVWGALLGACRIHRNIELGEQ
B8LQA8__________________LVDQGLQYFQCMKSDYGLAPKLEHYACLVDLLGRAGHLDEANGIIKNMSLEPDANVWGALLGACRIHCNIELGEQ
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
