|
||||||
|
UniGene Name: biog3_v1.0_unigene14540
Length: 245 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
 UniGene Fasta (sense)
|
|---|
| >biog3_v1.0_unigene14540
T |
|
Ace file of the UniGene biog3_v1.0_unigene14540 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Parent Assembly | Parent UniGene | Reads (related/total) |
|---|---|---|
| SustainPine v2.0 | sp_v2.0_unigene7201 | 2/3 |
| SustainPine v2.0 | sp_v2.0_unigene8052 | 1/3 |
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | putative aminotransferase [Arabidopsis thaliana] | - | - | 0.0 | 74% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 82% |
| Blast2go | aminotransferase -like | - | - | 0.0 | 89% |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Aspartate transaminase. | EC:2.6.1.1 | - | 0.0 | 89% |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Alanine, aspartate and glutamate metabolism | 00250 | 0.0 | 89% | |
| Blast2go | Cysteine and methionine metabolism | 00270 | 0.0 | 89% | |
| Blast2go | Arginine and proline metabolism | 00330 | 0.0 | 89% | |
| Blast2go | Tyrosine metabolism | 00350 | 0.0 | 89% | |
| Blast2go | Phenylalanine metabolism | 00360 | 0.0 | 89% | |
| Blast2go | Phenylalanine, tyrosine and tryptophan biosynthesis | 00400 | 0.0 | 89% | |
| Blast2go | Carbon fixation in photosynthetic organisms | 00710 | 0.0 | 89% | |
| Blast2go | Isoquinoline alkaloid biosynthesis | 00950 | 0.0 | 89% | |
| Blast2go | Tropane, piperidine and pyridine alkaloid biosynthesis | 00960 | 0.0 | 89% | |
| Blast2go | Biosynthesis of phenylpropanoids | 01061 | 0.0 | 89% | |
| Blast2go | Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid | 01064 | 0.0 | 89% | |
| Blast2go | Biosynthesis of plant hormones | 01070 | 0.0 | 89% | |
| Blast2go | Metabolic pathways | 01100 | 0.0 | 89% | |
| Blast2go | Biosynthesis of secondary metabolites | 01110 | 0.0 | 89% | |
| Blast2go | 1-aminocyclopropane-1-carboxylate synthase. | EC:4.4.1.14 | - | 0.0 | 89% |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Cysteine and methionine metabolism | 00270 | 0.0 | 89% | |
| Blast2go | Biosynthesis of plant hormones | 01070 | 0.0 | 89% | |
| Blast2go | Metabolic pathways | 01100 | 0.0 | 89% | |
| Blast2go | Biosynthesis of secondary metabolites | 01110 | 0.0 | 89% |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | 1-aminocyclopropane-1-carboxylate biosynthetic process | GO:0042218 | Biological Process | 0.0 | 89% |
| Blast2go | pyridoxal phosphate binding | GO:0030170 | Molecular Function | 0.0 | 89% |
| Blast2go | L-aspartate:2-oxoglutarate aminotransferase activity | GO:0004069 | Molecular Function | 0.0 | 89% |
| Blast2go | 1-aminocyclopropane-1-carboxylate synthase activity | GO:0016847 | Molecular Function | 0.0 | 89% |
| Blast2go | plastid | GO:0009536 | Cellular Component | 0.0 | 89% |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | 1-aminocyclopropane-1-carboxylate synthase | IPR001176 | - | 0.0 | - |
| Sma3 | Aminotransferase, class I/classII | IPR004839 | - | 0.0 | - |
| Sma3 | Pyridoxal phosphate-dependent transferase, major region, subdomain 1 | IPR015421 | - | 0.0 | - |
| Sma3 | Pyridoxal phosphate-dependent transferase, major region, subdomain 2 | IPR015422 | - | 0.0 | - |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5ADH5
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 104 aas, your sequence is shorter than subject: 53 - 437
Fln protein:
L
Protein Length:
54
Fln nts:
T
Fln Alignment:
biogeco3_mira_c7887___LGGAGVRQLPIEGKFITFTAIGIYIDSAIVPHLASKWKGK
D5ADH5__________________LGGAGVRQLPIQGKVITFTTIGVYIDSAIVPYLANKWRGK
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
