|
||||||
|
UniGene Name: biog3_v1.0_unigene12000
Length: 189 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
 UniGene Fasta (sense)
|
|---|
| >biog3_v1.0_unigene12000
C |
|
Ace file of the UniGene biog3_v1.0_unigene12000 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Parent Assembly | Parent UniGene | Reads (related/total) |
|---|---|---|
| SustainPine v2.0 | sp_v2.0_unigene3057 | 3/3 |
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | RecName: Full=Putative pleiotropic drug resistance protein 7 emb|CAD59570.1| PDR-like ABC transporter [Oryza sativa Japonica Group] dbj|BAD24998.1| PDR-like ABC transporter [Oryza sativa Japonica Group] dbj|BAD25007.1| PDR-like ABC transporter [Oryza sati | - | - | 0.0 | 71% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 53% |
| Blast2go | atp-binding cassette | - | - | 0.0 | 80% |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Phosphonate-transporting ATPase. | EC:3.6.3.28 | - | 0.0 | 80% |
| Blast2go | Polyamine-transporting ATPase. | EC:3.6.3.31 | - | 0.0 | 80% |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | drug transmembrane transport | GO:0006855 | Biological Process | 0.0 | 80% |
| Blast2go | ATP catabolic process | GO:0006200 | Biological Process | 0.0 | 80% |
| Blast2go | organic phosphonate transmembrane-transporting ATPase activity | GO:0015416 | Molecular Function | 0.0 | 80% |
| Blast2go | ATP binding | GO:0005524 | Molecular Function | 0.0 | 80% |
| Blast2go | polyamine-transporting ATPase activity | GO:0015417 | Molecular Function | 0.0 | 80% |
| Blast2go | membrane | GO:0016020 | Cellular Component | 0.0 | 80% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5ACV1
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 65 aas, your sequence is shorter than subject: 60 - 412
Fln protein:
G
Protein Length:
61
Fln nts:
C
Fln Alignment:
Contig12000___GMMNVAITPNHNVAAIAAAPFFMLWNLFSGFMIPHRMIP
D5ACV1__________________GMMAVALTPGHQIAAIVSSFFYGFWNIFSGFLITRPQIP
| SNPs (tot: 2) |
|---|
| Position | A % | C % | G % | T % | Probability |
|---|---|---|---|---|---|
| 37 | 75 | 25 | 0.996473 | ||
| 38 | 25 | 75 | 0.996473 |
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
