SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: biogeco3 v1.0

UniGene Name: biog3_v1.0_unigene10774

Length: 452 nt

This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense

UniGene Fasta (sense)

>biog3_v1.0_unigene10774
AATGTGTATGGAAACGTGGAGGCAACAAAAAAGGCAGTTCAACCTGGAAAGACAGCAGCCATTTTTGTTGAACCTGTTCAGGGAGAGGGAGGCATATATAGCGCCACAAGGGATTTTCTCTAAAGAATTGCGGACTCTCTGTGATTGGCTGTAGGTGCCTTGCTTGTCTTTGATGAGGTTCAATGTGGGCTGGGTCGAACAGGATATCTTTGGGCACATCAAATTTATGATGTGCAGCCAGACATAATGACTTTGGCAAAGCCTCTGGCTGGAGGTTTACCGATTGGTGCTGTTCTATTAACAGATAAGGTGGCCGGGGCTATAGGTCCTGGGGATCATGGAAGTACTTTCGCTGGAGGGCCTCTTGTCTGCCATGCTGCTCTTGCAGTGTTGGATAGAATTCAAGCTCCTGGGTTTCTAGAAAGTGTGACTACTAAAGGGCATTATACATT

Ace file of the UniGene biog3_v1.0_unigene10774 (antisense)

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Parent Assembly	Parent UniGene	Reads (related/total)
SustainPine v2.0	sp_v2.0_unigene52	9/9

Source	Descriptions	Term	Type	Identity
AutoFact	RecName: Full=Acetylornithine aminotransferase, mitochondrial; Short=ACOAT; AltName: Full=Acetylornithine transaminase; Short=AOTA; Flags: Precursor emb\|CAA69936.1\| acetylornithine aminotransferase [Alnus glutinosa]	-	-	66%
FL-Next	tr=Ornithine aminotransferase; Pinus sylvestris (Scots pine).	-	-	34%
Blast2go	protein	-	-	79%

Source	ECs	Term	Type	e value	Identity
Blast2go	Acetylornithine transaminase.	EC:2.6.1.11	-	0.0	79%

Source	KEGGs	Term	Identity
Blast2go	Lysine biosynthesis	00300	79%
Blast2go	Arginine and proline metabolism	00330	79%
Blast2go	Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid	01064	79%
Blast2go	Metabolic pathways	01100	79%
Blast2go	Biosynthesis of secondary metabolites	01110	79%

Source	GOs	Term	Type	Identity
Blast2go	response to water deprivation	GO:0009414	Biological Process	79%
Blast2go	arginine biosynthetic process	GO:0006526	Biological Process	79%
Blast2go	defense response to bacterium	GO:0042742	Biological Process	79%
Blast2go	regulation of transcription, DNA-dependent	GO:0006355	Biological Process	79%
Blast2go	transcription initiation, DNA-dependent	GO:0006352	Biological Process	79%
Blast2go	cutin biosynthetic process	GO:0010143	Biological Process	79%
Blast2go	wax metabolic process	GO:0010166	Biological Process	79%
Blast2go	interspecies interaction between organisms	GO:0044419	Biological Process	79%
Blast2go	ethylene mediated signaling pathway	GO:0009873	Biological Process	79%
Blast2go	copper ion binding	GO:0005507	Molecular Function	79%
Blast2go	N2-acetyl-L-ornithine:2-oxoglutarate 5-aminotransferase activity	GO:0003992	Molecular Function	79%
Blast2go	sequence-specific DNA binding	GO:0043565	Molecular Function	79%
Blast2go	sequence-specific DNA binding transcription factor activity	GO:0003700	Molecular Function	79%
Blast2go	pyridoxal phosphate binding	GO:0030170	Molecular Function	79%
Blast2go	RNA polymerase II transcription factor activity	GO:0003702	Molecular Function	79%
Blast2go	mitochondrion	GO:0005739	Cellular Component	79%
Blast2go	chloroplast stroma	GO:0009570	Cellular Component	79%
Blast2go	nucleus	GO:0005634	Cellular Component	79%

Source	InterPros	Term	Type	Identity
Sma3	Acetylornithine/Succinylornithine aminotransferase	IPR004636	-	-
Sma3	Aminotransferase class-III	IPR005814	-	-
Sma3	Pyridoxal phosphate-dependent transferase, major region, subdomain 1	IPR015421	-	-
Sma3	Pyridoxal phosphate-dependent transferase, major region, subdomain 2	IPR015422	-	-

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: Q1RPP3

Fln msg: Distance to subject end: 114 aas, your sequence is shorter than subject: 150 - 468

Fln protein: NVYGNVEATKKAVQPGKTAAIFVEPVQGEGGIYSATRDFL*RIADSL*LAVGALLVFDEVQCGLGRTGYLWAHQIYDVQPDIMTLAKPLAGGLPIGAVLLTDKVAGAIGPGDHGSTFAGGPLVCHAALAVLDRIQAPGFLESVTTKGHYT

Protein Length: 151

Fln nts: AATGTGTATGGAAACGTGGAGGCAACAAAAAAGGCAGTTCAACCTGGAAAGACAGCAGCCATTTTTGTTGAACCTGTTCAGGGAGAGGGAGGCATATATAGCGCCACAAGGGATTTTCTCTAAAGAATTGCGGACTCTCTGTGATTGGCTGTAGGTGCCTTGCTTGTCTTTGATGAGGTTCAATGTGGGCTGGGTCGAACAGGATATCTTTGGGCACATCAAATTTATGATGTGCAGCCAGACATAATGACTTTGGCAAAGCCTCTGGCTGGAGGTTTACCGATTGGTGCTGTTCTATTAACAGATAAGGTGGCCGGGGCTATAGGTCCTGGGGATCATGGAAGTACTTTCGCTGGAGGGCCTCTTGTCTGCCATGCTGCTCTTGCAGTGTTGGATAGAATTCAAGCTCCTGGGTTTCTAGAAAGTGTGACTACTAAAGGGCATTATACATT

Fln Alignment:

Contig10774___YGNVEATKKAVQP--GKTAAIFVEPVQGEGGIYSATRDFL*RIADSL*LAVGALLVFDEVQCGLGRTGYLWAHQIYDVQPDIMTLAKPLAGG-LPIGAVLLTDKVAGAIGPGDHGSTFAGGPLVCHAALAVLDRIQAPGFLESVTTKG
Q1RPP3__________________FGDADSLKSMFEAHGDKVAGFLFEPIQGEAGVIVPPKGYLQSVRE-LCSKYNVLMIADEIQTGIGRTGKLLACEWESVRPDVVILGKALGGGVLPVSAVLADKDIMLCFKPGEHGSTFGGNPLASAVAIAALEIVEEEKLAERAAEMG

SNPs (tot: 8)

Position	A %	C %	G %	T %	Probability
159	25		75		0.996473
160	75			25	0.996473
161	75		25		0.996473
162		75		25	0.996473
224	20	80			0.995493
227		80		20	0.995493
308		66	33		1.0
311	66		16		0.988813

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain