|
||||||
|
UniGene Name: biog3_v1.0_unigene6852
Length: 234 nt
 UniGene Fasta
|
|---|
| >biog3_v1.0_unigene6852
C |
|
Ace file of the UniGene biog3_v1.0_unigene6852
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Parent Assembly | Parent UniGene | Reads (related/total) |
|---|---|---|
| SustainPine v2.0 | sp_v2.0_unigene8991 | 6/6 |
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | RecName: Full=Glyoxysomal fatty acid beta-oxidation multifunctional protein MFP-a; Includes: RecName: Full=Enoyl-CoA hydratase/3-2-trans-enoyl-CoA isomerase/3-hydroxybutyryl-CoA epimerase; Includes: RecName: Full=3-hydroxyacyl-CoA dehydrogenase emb|CAA556 | - | - | 0.0 | 49% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 51% |
| Blast2go | peroxisomal fatty acid beta-oxidation multifunctional protein | - | - | 0.0 | 70% |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Dodecenoyl-CoA isomerase. | EC:5.3.3.8 | - | 0.0 | 70% |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Fatty acid metabolism | 00071 | 0.0 | 70% | |
| Blast2go | Enoyl-CoA hydratase. | EC:4.2.1.17 | - | 0.0 | 70% |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Fatty acid elongation in mitochondria | 00062 | 0.0 | 70% | |
| Blast2go | Fatty acid metabolism | 00071 | 0.0 | 70% | |
| Blast2go | Valine, leucine and isoleucine degradation | 00280 | 0.0 | 70% | |
| Blast2go | Geraniol degradation | 00281 | 0.0 | 70% | |
| Blast2go | Lysine degradation | 00310 | 0.0 | 70% | |
| Blast2go | Benzoate degradation | 00362 | 0.0 | 70% | |
| Blast2go | Tryptophan metabolism | 00380 | 0.0 | 70% | |
| Blast2go | beta-Alanine metabolism | 00410 | 0.0 | 70% | |
| Blast2go | alpha-Linolenic acid metabolism | 00592 | 0.0 | 70% | |
| Blast2go | Aminobenzoate degradation | 00627 | 0.0 | 70% | |
| Blast2go | Propanoate metabolism | 00640 | 0.0 | 70% | |
| Blast2go | Butanoate metabolism | 00650 | 0.0 | 70% | |
| Blast2go | Limonene and pinene degradation | 00903 | 0.0 | 70% | |
| Blast2go | Biosynthesis of unsaturated fatty acids | 01040 | 0.0 | 70% | |
| Blast2go | Biosynthesis of plant hormones | 01070 | 0.0 | 70% | |
| Blast2go | Metabolic pathways | 01100 | 0.0 | 70% | |
| Blast2go | Biosynthesis of secondary metabolites | 01110 | 0.0 | 70% | |
| Blast2go | 3-hydroxybutyryl-CoA epimerase. | EC:5.1.2.3 | - | 0.0 | 70% |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Fatty acid metabolism | 00071 | 0.0 | 70% | |
| Blast2go | Butanoate metabolism | 00650 | 0.0 | 70% |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | fatty acid beta-oxidation | GO:0006635 | Biological Process | 0.0 | 70% |
| Blast2go | binding | GO:0005488 | Molecular Function | 0.0 | 70% |
| Blast2go | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | 70% |
| Blast2go | 3-hydroxyacyl-CoA dehydratase activity | GO:0018812 | Molecular Function | 0.0 | 70% |
| Blast2go | dodecenoyl-CoA delta-isomerase activity | GO:0004165 | Molecular Function | 0.0 | 70% |
| Blast2go | enoyl-CoA hydratase activity | GO:0004300 | Molecular Function | 0.0 | 70% |
| Blast2go | 3-hydroxybutyryl-CoA epimerase activity | GO:0008692 | Molecular Function | 0.0 | 70% |
| Blast2go | glyoxysome | GO:0009514 | Cellular Component | 0.0 | 70% |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Crotonase, core | IPR001753 | - | 0.0 | - |
| Sma3 | CD36 antigen | IPR002159 | - | 0.0 | - |
| Sma3 | 3-hydroxyacyl-CoA dehydrogenase, C-terminal | IPR006108 | - | 0.0 | - |
| Sma3 | 3-hydroxyacyl-CoA dehydrogenase, NAD binding | IPR006176 | - | 0.0 | - |
| Sma3 | 3-hydroxyacyl-CoA dehydrogenase, conserved site | IPR006180 | - | 0.0 | - |
| Sma3 | Dehydrogenase, multihelical | IPR013328 | - | 0.0 | - |
| Sma3 | NAD(P)-binding domain | IPR016040 | - | 0.0 | - |
| Sma3 | Enoyl-CoA hydratase/isomerase, conserved site | IPR018376 | - | 0.0 | - |
| Full-Lengther Next Prediction |
|---|
Fln status: C-terminus
Fln database: coniferopsida.fasta
Fln subject: B8LR51
Fln msg: Unexpected stop codon in the beginning of your sequence, your sequence is shorter than subject: 76 - 723
Fln protein:
Q
Protein Length:
77
Fln nts:
C
Fln Alignment:
Contig6852___IGNGLPSIQGGIAFWGDHIGAGYIFSKLLKWANMYGNFFKPSEALEKCATQKIPLA
B8LR51_________________LGMGFPSYRGGIVFWADSVGAGHIYSSLKKWYESYGGLFKPCAYLEERAARGIPLS
| SNPs (tot: 9) |
|---|
| Position | A % | C % | G % | T % | Probability |
|---|---|---|---|---|---|
| 72 | 14 | 85 | 0.993533 | ||
| 73 | 14 | 85 | 0.993533 | ||
| 74 | 85 | 14 | 0.993533 | ||
| 76 | 85 | 14 | 0.993533 | ||
| 190 | 20 | 80 | 0.995493 | ||
| 192 | 20 | 80 | 0.995493 | ||
| 209 | 25 | 75 | 0.996473 | ||
| 213 | 75 | 25 | 0.996473 | ||
| 214 | 75 | 25 | 0.996473 |
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
