SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: biogeco3 v1.0

UniGene Name: biog3_v1.0_unigene6843

Length: 234 nt

This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense

UniGene Fasta (sense)

>biog3_v1.0_unigene6843
TTGACAAAGGTCGTGTGGCCTAGAGAGTCCAACTAATCCACGTCAGAAAATATCTGATATACGGAAAATTTCGGAAATAGCACATGCACATGGTGCACTGGTACTTGTTGACAACAGTATCATGTCTCCTGTACTATCAAGACCATTGGAGCTTGGAGCAGATATTGTGATGCATTCAGCAACTAAATTCATAGCTGGACATAGTGATGTCATGGCAGGTGTTCTTGCTGTAAA

Ace file of the UniGene biog3_v1.0_unigene6843 (antisense)

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Parent Assembly	Parent UniGene	Reads (related/total)
SustainPine v2.0	sp_v2.0_unigene2695	6/6

Source	Descriptions	Term	Type	Identity
AutoFact	Cystathionine beta-lyase, putative n=1 Tax=Ricinus communis RepID=B9RGV9_RICCO	-	-	71%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	53%
Blast2go	cystathionine beta-lyase	-	-	87%

Source	ECs	Term	Type	e value	Identity
Blast2go	Cystathionine gamma-lyase.	EC:4.4.1.1	-	0.0	87%

Source	KEGGs	Term	Type	Identity
Blast2go	Glycine, serine and threonine metabolism	00260		87%
Blast2go	Cysteine and methionine metabolism	00270		87%
Blast2go	Selenocompound metabolism	00450		87%
Blast2go	Nitrogen metabolism	00910		87%
Blast2go	Metabolic pathways	01100		87%
Blast2go	Cystathionine beta-lyase.	EC:4.4.1.8	-	87%

Source	KEGGs	Term	Identity
Blast2go	Cysteine and methionine metabolism	00270	87%
Blast2go	Selenocompound metabolism	00450	87%
Blast2go	Nitrogen metabolism	00910	87%
Blast2go	Sulfur metabolism	00920	87%
Blast2go	Biosynthesis of plant hormones	01070	87%
Blast2go	Metabolic pathways	01100	87%
Blast2go	Biosynthesis of secondary metabolites	01110	87%

Source	GOs	Term	Type	Identity
Blast2go	L-methionine biosynthetic process from L-homoserine via cystathionine	GO:0019279	Biological Process	87%
Blast2go	L-cysteine desulfhydrase activity	GO:0080146	Molecular Function	87%
Blast2go	cystathionine beta-lyase activity	GO:0004121	Molecular Function	87%
Blast2go	pyridoxal phosphate binding	GO:0030170	Molecular Function	87%
Blast2go	cystathionine gamma-lyase activity	GO:0004123	Molecular Function	87%
Blast2go	chloroplast	GO:0009507	Cellular Component	87%

Source	InterPros	Term	Type	Identity
Sma3	Cys/Met metabolism, pyridoxal phosphate-dependent enzyme	IPR000277	-	-
Sma3	Cystathionine beta-lyase, eukaryotic	IPR006238	-	-
Sma3	Pyridoxal phosphate-dependent transferase, major region, subdomain 1	IPR015421	-	-
Sma3	Pyridoxal phosphate-dependent transferase, major region, subdomain 2	IPR015422	-	-

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: B8LL39

Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 168 aas, your sequence is shorter than subject: 77 - 521

Fln protein: *QRSCGLESPTNPRQKISDIRKISEIAHAHGALVLVDNSIMSPVLSRPLELGADIVMHSATKFIAGHSDVMAGVLAV

Protein Length: 78

Fln nts: TTGACAAAGGTCGTGTGGCCTAGAGAGTCCAACTAATCCACGTCAGAAAATATCTGATATACGGAAAATTTCGGAAATAGCACATGCACATGGTGCACTGGTACTTGTTGACAACAGTATCATGTCTCCTGTACTATCAAGACCATTGGAGCTTGGAGCAGATATTGTGATGCATTCAGCAACTAAATTCATAGCTGGACATAGTGATGTCATGGCAGGTGTTCTTGCTGTAAA

Fln Alignment:

Contig6843___ESPTNPRQKISDIRKISEIAHAHGALVLVDNSIMSPVLSRPLELGADIVMHSATKFIAGHSDVMAGVLA
B8LL39_________________ESPTNPYLRCIDIELVSKICHRKGVLVCIDCTFATPVNQKALALGADIVLHSVTKYIAGHNDVLAGSLS

SNPs (tot: 8)

Position	A %	C %	T %	Probability
42	20		80	0.995493
46	80		20	0.995493
57		20	80	0.995493
124	16		83	0.994512
127	83		16	0.994512
128		83	16	0.994512
187		33	66	0.997452
188	33		66	0.997452

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain