SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: biogeco3 v1.0

UniGene Name: biog3_v1.0_unigene6713

Length: 486 nt

This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense

UniGene Fasta (sense)

>biog3_v1.0_unigene6713
TGCAGGCTCTGACCCATGCTCGAGTACCTATTGTGAAATTCACTGACCCACTGACTGCAATTTCCTGTGACATTTGCATCAATAATATCCTGGCAGTCGTAAATACAAAGCTTCTCTATGATTATGCACAAATAGATGTCCGTTTACAGCAACTTGCATTCATGGTAAAGCATTGGGCAAAAAGTCGGCAGATCAATGAGACATATCAGGGCACTCTATCTAGCTATGCGTATGTGCTTATGTGCATTCACTTTCTACAACAGCGCAGACCTCCGATTCTTCCTTGCTTACAGGAAATGGAAGCAACATACCAAGTTGTGATCGGTGAGATTGAATGTGCTTACTACGATCAAGTTGAGAAACTGAAAAACTATGGTGCTGGAAACAAGGAAACCCTTGGTCAATTGCTATCAGCTTTCTTTCACTACTGGGCATTTCGTCATGATTATGCCAATTCTGTGATATCAGTTCGCACTGGAGGGCTTC

Ace file of the UniGene biog3_v1.0_unigene6713 (antisense)

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Parent Assembly	Parent UniGene	Reads (related/total)
SustainPine v2.0	sp_v2.0_unigene87	6/6

Source	Descriptions	Term	Type	Identity
AutoFact	nucleotidyltransferase-like protein [Arabidopsis thaliana] gb\|AAK25891.1\|AF360181_1 unknown protein [Arabidopsis thaliana] gb\|AAK64074.1\| unknown protein [Arabidopsis thaliana] gb\|AAC06161.2\| expressed protein [Arabidopsis thaliana] gb\|AEC10577.1\| nucleot	-	-	50%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	87%
Blast2go	nucleotidyltransferase-like protein	-	-	77%

Source	ECs	Term	Type	e value	Identity
Blast2go	Transferases, Transferring phosphorous-containing groups, Nucleotidyltransferases.	EC:2.7.7.-	-	0.0	77%

Source	KEGGs	Term	Type	Identity
Blast2go	Amino sugar and nucleotide sugar metabolism	00520		77%
Blast2go	Lipopolysaccharide biosynthesis	00540		77%
Blast2go	Biosynthesis of siderophore group nonribosomal peptides	01053		77%
Blast2go	Metabolic pathways	01100		77%
Blast2go	Oxidoreductases, Acting on the CH-OH group of donors, With NAD(+) or NADP(+) as acceptor.	EC:1.1.1.-	-	77%

Source	KEGGs	Term	Identity
Blast2go	Fructose and mannose metabolism	00051	77%
Blast2go	Ascorbate and aldarate metabolism	00053	77%
Blast2go	Steroid hormone biosynthesis	00140	77%
Blast2go	Tetracycline biosynthesis	00253	77%
Blast2go	Glycine, serine and threonine metabolism	00260	77%
Blast2go	Benzoate degradation	00362	77%
Blast2go	Bisphenol degradation	00363	77%
Blast2go	Amino sugar and nucleotide sugar metabolism	00520	77%
Blast2go	Polyketide sugar unit biosynthesis	00523	77%
Blast2go	Linoleic acid metabolism	00591	77%
Blast2go	Xylene degradation	00622	77%
Blast2go	Chloroalkane and chloroalkene degradation	00625	77%
Blast2go	Nitrotoluene degradation	00633	77%
Blast2go	Butanoate metabolism	00650	77%
Blast2go	Carbon fixation pathways in prokaryotes	00720	77%
Blast2go	Retinol metabolism	00830	77%
Blast2go	Isoquinoline alkaloid biosynthesis	00950	77%
Blast2go	Glucosinolate biosynthesis	00966	77%
Blast2go	Insect hormone biosynthesis	00981	77%
Blast2go	Biosynthesis of unsaturated fatty acids	01040	77%
Blast2go	Biosynthesis of type II polyketide backbone	01056	77%
Blast2go	Biosynthesis of type II polyketide products	01057	77%
Blast2go	Biosynthesis of alkaloids derived from shikimate pathway	01063	77%
Blast2go	Metabolic pathways	01100	77%
Blast2go	Biosynthesis of secondary metabolites	01110	77%

Source	GOs	Term	Type	Identity
Blast2go	metabolic process	GO:0008152	Biological Process	77%
Blast2go	NAD binding	GO:0051287	Molecular Function	77%
Blast2go	nucleotidyltransferase activity	GO:0016779	Molecular Function	77%
Blast2go	oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor	GO:0016616	Molecular Function	77%
Blast2go	plastid	GO:0009536	Cellular Component	77%

Source	InterPros	Term	Type	Identity
Sma3	PAP/25A-associated	IPR002058	-	-
Sma3	Nucleotidyl transferase domain	IPR002934	-	-
Sma3	Aldehyde dehydrogenase, conserved site	IPR016160	-	-

Full-Lengther Next Prediction

Fln status: N-terminus

Fln database: coniferopsida.fasta

Fln subject: D5A7Y7

Fln msg: Distance to subject end: 71 aas, your sequence is shorter than subject: 108 - 134

Fln protein: MVKHWAKSRQINETYQGTLSSYAYVLMCIHFLQQRRPPILPCLQEMEATYQVVIGEIECAYYDQVEKLKNYGAGNKETLGQLLSAFFHYWAFRHDYANSVISVRTGGL

Protein Length: 109

Fln nts: TGCAGGCTCTGACCCATGCTCGAGTACCTATTGTGAAATTCACTGACCCACTGACTGCAATTTCCTGTGACATTTGCATCAATAATATCCTGGCAGTCGTAAATACAAAGCTTCTCTATGATTATGCACAAATAGATGTCCGTTTACAGCAACTTGCATTC_-_ATGGTAAAGCATTGGGCAAAAAGTCGGCAGATCAATGAGACATATCAGGGCACTCTATCTAGCTATGCGTATGTGCTTATGTGCATTCACTTTCTACAACAGCGCAGACCTCCGATTCTTCCTTGCTTACAGGAAATGGAAGCAACATACCAAGTTGTGATCGGTGAGATTGAATGTGCTTACTACGATCAAGTTGAGAAACTGAAAAACTATGGTGCTGGAAACAAGGAAACCCTTGGTCAATTGCTATCAGCTTTCTTTCACTACTGGGCATTTCGTCATGATTATGCCAATTCTGTGATATCAGTTCGCACTGGAGGGCTTC

Fln Alignment:

Contig6713___MEATYQVVIGEIECAYYDQVEKLKNYGAGNKETLGQLLSAFFHYWAFRHDYANSVISVRTGGL
D5A7Y7_________________MEATYQVMIGKIQCAYYDQVDKLKNYGARNKETLGQLLSAFFYYWAFHHEYANSVISVRTGGL

SNPs (tot: 8)

Position	A %	G %	T %	Probability
125	16	83		0.994512
201	16	83		0.994512
204	83		16	0.994512
205		83	16	0.994512
265	16	83		0.994512
268	83		16	0.994512
290	20		80	0.995493
333		75	25	0.996473

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain