SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: biogeco3 v1.0

UniGene Name: biog3_v1.0_unigene206

Length: 453 nt

UniGene Fasta

>biog3_v1.0_unigene206
AATGTAAAGCTTGATACCAGTTATCCAGGTGGGTTGCGTTCATATATACATAATGCTAGGCAACTCTTGGCAGATTCAAAAGCTGGGAAGAATCCATTTAGTGGCTTTAGCCCTTCAGTACCAGCTGGTGAGGTGTTGTCATTTGGTGATGAGAATTTTATCAAATTTGAAGAAGCTGGGATTAGGGAAGCATGTGATGCTGCATTTGTTCTTGTAGCCGGGGGACTTGGGGAGCGTCTTGGTTATGGTGGTATCAAATTGGCACTGCCTTCAGAAACAACAACTGGAACTTGCTTCTTACAATTGTATGTAGAGGTTATACTGGCTCTCCAGGAAGCTAGCTGTAAACAGAAGGAAGGGAATGTTGACAGGCATATTCCCTTAGTGATAATGACATAGATTATACACACAGCCGAACTCAAGAGCTTCTTGAATCAAATGCATATTTACATT

Ace file of the UniGene biog3_v1.0_unigene206

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Parent Assembly	Parent UniGene	Reads (related/total)
SustainPine v2.0	sp_v2.0_unigene2009	5/5

Source	Descriptions	Term	Type	Identity
AutoFact	UDP-n-acteylglucosamine pyrophosphorylase, putative n=1 Tax=Ricinus communis RepID=B9S2T0_RICCO	-	-	70%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	93%
Blast2go	udp-sugar pyrophosphorylase	-	-	84%

Source	ECs	Term	Type	e value	Identity
Blast2go	UTP--xylose-1-phosphate uridylyltransferase.	EC:2.7.7.11	-	0.0	84%

Source	KEGGs	Term	Type	Identity
Blast2go	Amino sugar and nucleotide sugar metabolism	00520		84%
Blast2go		EC:2.7.7.1-	-	84%
Blast2go	Glucuronate-1-phosphate uridylyltransferase.	EC:2.7.7.44	-	84%

Source	KEGGs	Term	Type	Identity
Blast2go	Pentose and glucuronate interconversions	00040		84%
Blast2go	Ascorbate and aldarate metabolism	00053		84%
Blast2go	Amino sugar and nucleotide sugar metabolism	00520		84%
Blast2go	Metabolic pathways	01100		84%
Blast2go	UTP--glucose-1-phosphate uridylyltransferase.	EC:2.7.7.9	-	84%

Source	KEGGs	Term	Identity
Blast2go	Pentose and glucuronate interconversions	00040	84%
Blast2go	Galactose metabolism	00052	84%
Blast2go	Starch and sucrose metabolism	00500	84%
Blast2go	Amino sugar and nucleotide sugar metabolism	00520	84%
Blast2go	Metabolic pathways	01100	84%
Blast2go	Biosynthesis of secondary metabolites	01110	84%

Source	GOs	Term	Type	Identity
Blast2go	pollen development	GO:0009555	Biological Process	84%
Blast2go	UDP-glucuronate metabolic process	GO:0046398	Biological Process	84%
Blast2go	response to cadmium ion	GO:0046686	Biological Process	84%
Blast2go	UDP-L-arabinose metabolic process	GO:0033356	Biological Process	84%
Blast2go	UDP-glucose metabolic process	GO:0006011	Biological Process	84%
Blast2go	UTP:arabinose-1-phosphate uridylyltransferase activity	GO:0010491	Molecular Function	84%
Blast2go	UTP:xylose-1-phosphate uridylyltransferase activity	GO:0047338	Molecular Function	84%
Blast2go	UTP:galactose-1-phosphate uridylyltransferase activity	GO:0017103	Molecular Function	84%
Blast2go	glucuronate-1-phosphate uridylyltransferase activity	GO:0047350	Molecular Function	84%
Blast2go	UTP:glucose-1-phosphate uridylyltransferase activity	GO:0003983	Molecular Function	84%
Blast2go	UDP-D-galactose metabolic process	GO:0052573	Biological Process	84%
Blast2go	pollen tube	GO:0090406	Biological Process	84%

Source	InterPros	Term	Type	e value	Identity
Sma3	UTP--glucose-1-phosphate uridylyltransferase	IPR002618	-	0.0	-

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: B8LMQ2

Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 405 aas, your sequence is shorter than subject: 133 - 632

Fln protein: NVKLDTSYPGGLRSYIHNARQLLADSKAGKNPFSGFSPSVPAGEVLSFGDENFIKFEEAGIREACDAAFVLVAGGLGERLGYGGIKLALPSETTTGTCFLQLYVEVILALQEASCKQKEGNVDRHIPLVIMT*

Protein Length: 134

Fln nts: AATGTAAAGCTTGATACCAGTTATCCAGGTGGGTTGCGTTCATATATACATAATGCTAGGCAACTCTTGGCAGATTCAAAAGCTGGGAAGAATCCATTTAGTGGCTTTAGCCCTTCAGTACCAGCTGGTGAGGTGTTGTCATTTGGTGATGAGAATTTTATCAAATTTGAAGAAGCTGGGATTAGGGAAGCATGTGATGCTGCATTTGTTCTTGTAGCCGGGGGACTTGGGGAGCGTCTTGGTTATGGTGGTATCAAATTGGCACTGCCTTCAGAAACAACAACTGGAACTTGCTTCTTACAATTGTATGTAGAGGTTATACTGGCTCTCCAGGAAGCTAGCTGTAAACAGAAGGAAGGGAATGTTGACAGGCATATTCCCTTAGTGATAATGACATAGATTATACACACAGCCGAACTCAAGAGCTTCTTGAATCAAATGCATATTTACATT

Fln Alignment:

Contig206___KLDTSYPGGLRSYIHNARQLLADSKAGKNPFSGFSPSVPAGEVLSFGDENFIKFEEAGIREACDAAFVLVAXXXXXXXXXXXIKLALPSETTTGTCFLQLYVEVILALQEASCKQKEGNVDRHIPLVIMT
B8LMQ2________________KLDASYPGGLRSYIHNARQLLTDSKAGKNPFDGFTPSVPAGEVLSFGDENFIKFEEAGIKEACDAAFVLVAGGLGERLGYGGIKLALPSETTTGTCFLQVYVESILALQEASCKQNEGNVDRHIPLVIMT

SNPs (tot: 2)

Position	A %	C %	G %	T %	Probability
306	20		80		0.995493
307		20		80	0.995493

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain