UniGene Name: mmc_v1.0_unigene74945
Length: 210 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense) |
---|
>mmc_v1.0_unigene74945
C |
Ace file of the UniGene mmc_v1.0_unigene74945 (antisense) |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Parent Assembly | Parent UniGene | Reads (related/total) |
---|---|---|
Solea senegalensis v1.0 (global assembly) | solea_v1.0_unigene2660 | 2/2 |
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
FL-Next | Q4SLA7 tr=Chromosome 7 SCAF14557, whole genome shotgun sequence; Tetraodon nigroviridis (Green puffer). | - | - | 0.0 | 75% |
AutoFact | similar to v-akt murine thymoma viral oncogene homolog 1; K04456 RAC serine/threonine-protein kinase [EC:2.7.11.1] | - | - | 0.0 | 95% |
Blast2go | v-akt murine thymoma viral oncogene homolog 1 | - | - | 0.0 | 97% |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
FL-2 | Non-specific serine/threonine protein kinase. | EC:2.7.11.1 | - | 0.0 | 95% |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | Transferases, Transferring phosphorous-containing groups, Protein-serine/threonine kinases. | EC:2.7.11.- | - | 0.0 | 97% |
Blast2go | Protein-synthesizing GTPase. | EC:3.6.5.3 | - | 0.0 | 97% |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | soluble fraction | GO:0005625 | Cellular Component | 0.0 | 97% |
Blast2go | lamellipodium | GO:0030027 | Cellular Component | 0.0 | 97% |
Blast2go | cytosol | GO:0005829 | Cellular Component | 0.0 | 97% |
Blast2go | nucleoplasm | GO:0005654 | Cellular Component | 0.0 | 97% |
Blast2go | plasma membrane | GO:0005886 | Cellular Component | 0.0 | 97% |
Blast2go | spindle | GO:0005819 | Cellular Component | 0.0 | 97% |
Blast2go | phosphatidylinositol-3,4-bisphosphate binding | GO:0043325 | Molecular Function | 0.0 | 97% |
Blast2go | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | 97% |
Blast2go | phosphatidylinositol-3,4,5-trisphosphate binding | GO:0005547 | Molecular Function | 0.0 | 97% |
Blast2go | identical protein binding | GO:0042802 | Molecular Function | 0.0 | 97% |
Blast2go | ATP binding | GO:0005524 | Molecular Function | 0.0 | 97% |
Blast2go | nitric-oxide synthase regulator activity | GO:0030235 | Molecular Function | 0.0 | 97% |
Blast2go | enzyme binding | GO:0019899 | Molecular Function | 0.0 | 97% |
Blast2go | inflammatory response | GO:0006954 | Biological Process | 0.0 | 97% |
Blast2go | regulation of cell migration | GO:0030334 | Biological Process | 0.0 | 97% |
Blast2go | glycogen cell differentiation involved in embryonic placenta development | GO:0060709 | Biological Process | 0.0 | 97% |
Blast2go | anagen | GO:0042640 | Biological Process | 0.0 | 97% |
Blast2go | negative regulation of JNK cascade | GO:0046329 | Biological Process | 0.0 | 97% |
Blast2go | protein kinase B signaling | GO:0043491 | Biological Process | 0.0 | 97% |
Blast2go | positive regulation of establishment of protein localization to plasma membrane | GO:0090004 | Biological Process | 0.0 | 97% |
Blast2go | positive regulation of nitric oxide biosynthetic process | GO:0045429 | Biological Process | 0.0 | 97% |
Blast2go | response to food | GO:0032094 | Biological Process | 0.0 | 97% |
Blast2go | response to fluid shear stress | GO:0034405 | Biological Process | 0.0 | 97% |
Blast2go | maternal placenta development | GO:0001893 | Biological Process | 0.0 | 97% |
Blast2go | negative regulation of fatty acid beta-oxidation | GO:0031999 | Biological Process | 0.0 | 97% |
Blast2go | positive regulation of glucose import | GO:0046326 | Biological Process | 0.0 | 97% |
Blast2go | positive regulation of sodium ion transport | GO:0010765 | Biological Process | 0.0 | 97% |
Blast2go | protein ubiquitination | GO:0016567 | Biological Process | 0.0 | 97% |
Blast2go | activation-induced cell death of T cells | GO:0006924 | Biological Process | 0.0 | 97% |
Blast2go | regulation of survival gene product expression | GO:0045884 | Biological Process | 0.0 | 97% |
Blast2go | positive regulation of glycogen biosynthetic process | GO:0045725 | Biological Process | 0.0 | 97% |
Blast2go | signal transduction | GO:0007165 | Biological Process | 0.0 | 97% |
Blast2go | positive regulation of cellular protein metabolic process | GO:0032270 | Biological Process | 0.0 | 97% |
Blast2go | negative regulation of plasma membrane long-chain fatty acid transport | GO:0010748 | Biological Process | 0.0 | 97% |
Blast2go | response to UV-A | GO:0070141 | Biological Process | 0.0 | 97% |
Blast2go | negative regulation of protein kinase activity | GO:0006469 | Biological Process | 0.0 | 97% |
Blast2go | regulation of neuron projection development | GO:0010975 | Biological Process | 0.0 | 97% |
Blast2go | protein import into nucleus, translocation | GO:0000060 | Biological Process | 0.0 | 97% |
Blast2go | positive regulation of cell growth | GO:0030307 | Biological Process | 0.0 | 97% |
Blast2go | insulin-like growth factor receptor signaling pathway | GO:0048009 | Biological Process | 0.0 | 97% |
Blast2go | germ cell development | GO:0007281 | Biological Process | 0.0 | 97% |
Blast2go | peptidyl-serine phosphorylation | GO:0018105 | Biological Process | 0.0 | 97% |
Blast2go | apoptotic mitochondrial changes | GO:0008637 | Biological Process | 0.0 | 97% |
Blast2go | positive regulation of nitric-oxide synthase activity | GO:0051000 | Biological Process | 0.0 | 97% |
Blast2go | activation of pro-apoptotic gene products | GO:0008633 | Biological Process | 0.0 | 97% |
Blast2go | positive regulation of lipid biosynthetic process | GO:0046889 | Biological Process | 0.0 | 97% |
Blast2go | negative regulation of cell size | GO:0045792 | Biological Process | 0.0 | 97% |
Blast2go | labyrinthine layer blood vessel development | GO:0060716 | Biological Process | 0.0 | 97% |
Blast2go | translation | GO:0006412 | Biological Process | 0.0 | 97% |
Blast2go | positive regulation of fat cell differentiation | GO:0045600 | Biological Process | 0.0 | 97% |
Blast2go | protein catabolic process | GO:0030163 | Biological Process | 0.0 | 97% |
Blast2go | insulin receptor signaling pathway | GO:0008286 | Biological Process | 0.0 | 97% |
Blast2go | positive regulation of cyclin-dependent protein serine/threonine kinase activity involved in G1/S transition of mitotic cell cycle | GO:0031659 | Biological Process | 0.0 | 97% |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | Protein kinase domain | IPR000719 | - | 0.0 | 97% |
Blast2go | Serine/threonine- /dual specificity protein kinase, catalytic domain | IPR002290 | - | 0.0 | 97% |
Blast2go | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | 97% |
Blast2go | Protein kinase-like domain | IPR011009 | - | 0.0 | 97% |
Blast2go | IPR017442 | - | 0.0 | 97% | |
Blast2go | Tyrosine-protein kinase, catalytic domain | IPR020635 | - | 0.0 | 97% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: actinopterygii100.fasta
Fln subject: Q4SLA7
Fln msg: Distance to subject end: 61 aas, your sequence is shorter than subject: 69 - 472
Fln protein:
Y
Protein Length:
70
Fln nts:
C
Fln Alignment:
mmc_c61130___YNKDHEKLWELILMEEIRFPRTLGPEARSLLSGLLKKEPMQRLGGGPDDAKEIMQHKFFAGIEWQDVYE
Q4SLA7________________YNQDHERLFELILMEDIRFPRNLSPEAKSLLAGLLKKDPKQRLGGGPDDAKEVMTHKFFTNINWQDVVQ
Curation |
---|
No curations to show
|
IFAPA Centro El Toruño. Ctra. N. IV Km. 654a. Camino de Tiro Pichón. El Puerto de Santa María (Cádiz), Spain. |