SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v1.1

UniGene Name: sp_v1.1_unigene11283

Length: 496 nt

Origin of reads: Biogeco_1 Uagpf Uma

This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense

UniGene Fasta (sense)

>sp_v1.1_unigene11283
CGTCGTGACCGTCGTGACAATGGAAGCTTTGGTGTGGTTTTGTTAGAGATTCTGAGTGGGAGAAAAGCACATGATACAGATTTTGATCCACCCAATATTGTCGAATGGGCAGCACCCGTGATCAGCCAGGGAAAGGCAGCAGTCATCCTAGACCGCAGTGTGGATTTACCACGAAATGTGGAACCTTTGCTCAGAATGGCTGATATTGCAGAGCTTTCTGTTAGGCAAGACCCAAACGAAAGACCAACCATGTCAGACGTGGCTACGTGGTTGGAGCAACTCGTCAGAACTAGCTCTTAGTAGTATTGTTTTTCTATCTACGATTGCGAGCATTCTTGACAAATTGAAGATTATTGCTTGAAAATTATTTTGCCTCGAGGGCAAAGCCAGCTGGGATGTTTTTGTCTAAAATTCAAGTTCAAATAGCATCTCATCTACCTGGTATTTACATTTTCCTTTTTACTCTTTAGGACATTGTACCAGAGAATGCGTCCTT

Ace file of the UniGene sp_v1.1_unigene11283 (antisense)

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	ATP binding protein, putative	-	-	5.0e-30	65%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	41%
Blast2go	atp binding	-	-	1.17408e-30	77%

Source	ECs	Term	Type	e value	Identity
Blast2go	Cinnamoyl-CoA reductase.	EC:1.2.1.44	-	1.17408e-30	77%

Source	KEGGs	Term	Type	e value	Identity
Blast2go	Phenylpropanoid biosynthesis	00940		1.17408e-30	77%
Blast2go	Biosynthesis of phenylpropanoids	01061		1.17408e-30	77%
Blast2go	Metabolic pathways	01100		1.17408e-30	77%
Blast2go	Biosynthesis of secondary metabolites	01110		1.17408e-30	77%
Blast2go	Transferases, Transferring phosphorous-containing groups, Protein-serine/threonine kinases.	EC:2.7.11.-	-	1.17408e-30	77%

Source	GOs	Term	Type	e value	Identity
Blast2go	protein phosphorylation	GO:0006468	Biological Process	1.17408e-30	77%
Blast2go	DNA duplex unwinding	GO:0032508	Biological Process	1.17408e-30	77%
Blast2go	carotenoid biosynthetic process	GO:0016117	Biological Process	1.17408e-30	77%
Blast2go	regulation of stomatal movement	GO:0010119	Biological Process	1.17408e-30	77%
Blast2go	etioplast organization	GO:0009662	Biological Process	1.17408e-30	77%
Blast2go	mRNA export from nucleus	GO:0006406	Biological Process	1.17408e-30	77%
Blast2go	negative regulation of flower development	GO:0009910	Biological Process	1.17408e-30	77%
Blast2go	auxin biosynthetic process	GO:0009851	Biological Process	1.17408e-30	77%
Blast2go	response to salt stress	GO:0009651	Biological Process	1.17408e-30	77%
Blast2go	positive regulation of histone methylation	GO:0031062	Biological Process	1.17408e-30	77%
Blast2go	lignin biosynthetic process	GO:0009809	Biological Process	1.17408e-30	77%
Blast2go	response to zinc ion	GO:0010043	Biological Process	1.17408e-30	77%
Blast2go	vegetative to reproductive phase transition of meristem	GO:0010228	Biological Process	1.17408e-30	77%
Blast2go	secondary shoot formation	GO:0010223	Biological Process	1.17408e-30	77%
Blast2go	response to cadmium ion	GO:0046686	Biological Process	1.17408e-30	77%
Blast2go	response to cold	GO:0009409	Biological Process	1.17408e-30	77%
Blast2go	innate immune response	GO:0045087	Biological Process	1.17408e-30	77%
Blast2go	regulation of gene expression, epigenetic	GO:0040029	Biological Process	1.17408e-30	77%
Blast2go	RNA secondary structure unwinding	GO:0010501	Biological Process	1.17408e-30	77%
Blast2go	circadian rhythm	GO:0007623	Biological Process	1.17408e-30	77%
Blast2go	histone methyltransferase activity (H3-K36 specific)	GO:0046975	Molecular Function	1.17408e-30	77%
Blast2go	single-stranded DNA binding	GO:0003697	Molecular Function	1.17408e-30	77%
Blast2go	cinnamoyl-CoA reductase activity	GO:0016621	Molecular Function	1.17408e-30	77%
Blast2go	protein serine/threonine kinase activity	GO:0004674	Molecular Function	1.17408e-30	77%
Blast2go	carotenoid isomerase activity	GO:0046608	Molecular Function	1.17408e-30	77%
Blast2go	RNA binding	GO:0003723	Molecular Function	1.17408e-30	77%
Blast2go	histone methyltransferase activity (H3-K4 specific)	GO:0042800	Molecular Function	1.17408e-30	77%
Blast2go	double-stranded DNA binding	GO:0003690	Molecular Function	1.17408e-30	77%
Blast2go	receptor activity	GO:0004872	Molecular Function	1.17408e-30	77%
Blast2go	protein homodimerization activity	GO:0042803	Molecular Function	1.17408e-30	77%
Blast2go	ATP binding	GO:0005524	Molecular Function	1.17408e-30	77%
Blast2go	chloroplast	GO:0009507	Cellular Component	1.17408e-30	77%
Blast2go	cell wall	GO:0005618	Cellular Component	1.17408e-30	77%
Blast2go	peroxisome	GO:0005777	Cellular Component	1.17408e-30	77%
Blast2go	nucleolus	GO:0005730	Cellular Component	1.17408e-30	77%
Blast2go	plasma membrane	GO:0005886	Cellular Component	1.17408e-30	77%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: B8LRZ4

Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 128 aas, your sequence is shorter than subject: 100 - 511

Fln protein: RRDRRDNGSFGVVLLEILSGRKAHDTDFDPPNIVEWAAPVISQGKAAVILDRSVDLPRNVEPLLRMADIAELSVRQDPNERPTMSDVATWLEQLVRTSS*

Protein Length: 101

Fln nts: CGTCGTGACCGTCGTGACAATGGAAGCTTTGGTGTGGTTTTGTTAGAGATTCTGAGTGGGAGAAAAGCACATGATACAGATTTTGATCCACCCAATATTGTCGAATGGGCAGCACCCGTGATCAGCCAGGGAAAGGCAGCAGTCATCCTAGACCGCAGTGTGGATTTACCACGAAATGTGGAACCTTTGCTCAGAATGGCTGATATTGCAGAGCTTTCTGTTAGGCAAGACCCAAACGAAAGACCAACCATGTCAGACGTGGCTACGTGGTTGGAGCAACTCGTCAGAACTAGCTCTTAGTAGTATTGTTTTTCTATCTACGATTGCGAGCATTCTTGACAAATTGAAGATTATTGCTTGAAAATTATTTTGCCTCGAGGGCAAAGCCAGCTGGGATGTTTTTGTCTAAAATTCAAGTTCAAATAGCATCTCATCTACCTGGTATTTACATTTTCCTTTTTACTCTTTAGGACATTGTACCAGAGAATGCGTCCTT

Fln Alignment:

sp_v1.1_unigene11283___RRDNGSFGVVLLEILSGRKAHDTDFDPPNIVEWAAPVISQGKAAVILDRSVDLPRNVEPLLRMADIAELSVRQDPNERPTMSDVATWLEQLVRT
B8LRZ4_______________KNDVFSFGILLLEIISGRNAIDVQYSPPSIVDWAMPLIRQNKILELYDPRLSPPKNLNTIKHMALIAARCVRSTEERRPSMNEVVEGLKQVSRS

SNPs (tot: 36)

Position	A %	C %	G %	T %	Probability
203	11		88		0.923564
206	88			11	0.923564
209	11			88	0.923564
210		88	11		0.923564
216	88	11			0.923564
217		11	88		0.923564
218	11			88	0.923564
219	11			88	0.923564
221		88	11		0.923564
228		90	10		0.90298
236		88	11		0.923564
238		88	11		0.923564
241	25			75	1.0
242		87	12		0.992554
243	12			87	0.992554
245	87	12			0.992554
248	12		12	75	0.975346
249		12	87		0.992554
250		12	87		0.992554
251	12			87	0.992554
252	25			75	1.0
253		12	87		0.992554
255	12			87	0.992554
258		14		85	0.993533
259			14	85	0.993533
260	14			85	0.993533
465		66		33	0.997452
466	66		33		0.997452
467	33	66			0.997452
468		66	33		0.997452
469	66			33	0.997452
470	66		33		0.997452
474	33			66	0.997452
475		33	33	33	0.997753
477		66	33		0.997452
479	33		33	33	0.997753

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain