SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene208515

Length: 263 nt

UniGene Fasta

>sp_v3.0_unigene208515
TTATTGAAGATTGCCATTGAGAAAGCAGGGTATACTGGCAAGGTTGTTATTGGTATGGATGTAGCTGCTTCTGAGTTTTATAAGTATGATTTGAACAATAATAATGGTAGCCAGAAGATATCAGGATCTGAGCTGATCAAGCTTTACGAATCGTTTATTGAGGATTATCCAATTGTATCTATAGAGGACCCATTTGATCAAGATGATTGGGCTCACTATGCACAATTTACGGCGACAATTGGGGAAAAGGTGCAAATTGTTGG

Ace file of the UniGene sp_v3.0_unigene208515

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Enolase n=3 Tax=Picea sitchensis RepID=B8LL07_PICSI	-	-	2.0e-39	90%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	90%
Sma3	Enolase	-	-	0.0	-

Source	ECs	Term	Type	e value	Identity
Sma3	Phosphopyruvate hydratase.	EC:4.2.1.11	-	0.0	-

Source	KEGGs	Term	Identity
Sma3	Glycolysis / Gluconeogenesis	00010	%
Sma3	Methane metabolism	00680	%
Sma3	Biosynthesis of phenylpropanoids	01061	%
Sma3	Biosynthesis of terpenoids and steroids	01062	%
Sma3	Biosynthesis of alkaloids derived from shikimate pathway	01063	%
Sma3	Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid	01064	%
Sma3	Biosynthesis of alkaloids derived from histidine and purine	01065	%
Sma3	Biosynthesis of alkaloids derived from terpenoid and polyketide	01066	%
Sma3	Biosynthesis of plant hormones	01070	%
Sma3	Metabolic pathways	01100	%
Sma3	Biosynthesis of secondary metabolites	01110	%

Source	Gene names
Sma3	AD709; At1g74030; At2g36530; CHLREDRAFT_83064; ENL; ENO; ENO1; ENO2; Eno; F1O11.16; F2P9.10; GSVIVT00021683001; GSVIVT00038473001; GapC4-eno3; LOC_Os03g14450; LOC_Os10g08550; MICPUCDRAFT_43957; MICPUN_107587; OSJNAb0015J03.9; OSJNBb0015J03.1; OSTLU_28765;

Source	GOs	Term	Type	Identity
Sma3	phosphopyruvate hydratase complex	GO:0000015	Cellular Component	-
Sma3	nucleus	GO:0005634	Cellular Component	-
Sma3	mitochondrial envelope	GO:0005740	Cellular Component	-
Sma3	plasma membrane	GO:0005886	Cellular Component	-
Sma3	chloroplast	GO:0009507	Cellular Component	-
Sma3	apoplast	GO:0048046	Cellular Component	-
Sma3	magnesium ion binding	GO:0000287	Molecular Function	-
Sma3	ubiquitin thiolesterase activity	GO:0004221	Molecular Function	-
Sma3	glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity	GO:0004365	Molecular Function	-
Sma3	phosphopyruvate hydratase activity	GO:0004634	Molecular Function	-
Sma3	copper ion binding	GO:0005507	Molecular Function	-
Sma3		GO:0008415	Molecular Function	-
Sma3	NAD binding	GO:0051287	Molecular Function	-
Sma3	glycolysis	GO:0006096	Biological Process	-
Sma3	ubiquitin-dependent protein catabolic process	GO:0006511	Biological Process	-
Sma3	response to cold	GO:0009409	Biological Process	-
Sma3	response to light stimulus	GO:0009416	Biological Process	-
Sma3	response to salt stress	GO:0009651	Biological Process	-
Sma3	response to cadmium ion	GO:0046686	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3		IPR000173	-	-
Sma3	Enolase	IPR000941	-	-
Sma3	Peptidase C19, ubiquitin carboxyl-terminal hydrolase 2	IPR001394	-	-
Sma3	Glyceraldehyde-3-phosphate dehydrogenase, type I	IPR006424	-	-
Sma3	Peptidase C19, ubiquitin carboxyl-terminal hydrolase 2, conserved site	IPR018200	-	-
Sma3	EF-Hand 1, calcium-binding site	IPR018247	-	-
Sma3	EF-HAND 2	IPR018249	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT2G36530.1	LOS2, ENO2 Enolase chr2:15321081-15323786 REVERSE LENGTH=444	2.0e-37	72%
RefSeq	Arabidopsis thaliana	NP_181192.1	bifunctional enolase 2/transcriptional activator [Arabidopsis thaliana]	3.0e-37	72%
RefSeq	Populus trichocarpa	XP_002322420.1	predicted protein [Populus trichocarpa]	2.0e-37	70%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: C0PQ35

Fln msg: Distance to subject end: 118 aas, your sequence is shorter than subject: 87 - 445

Fln protein: LLKIAIEKAGYTGKVVIGMDVAASEFYKYDLNNNNGSQKISGSELIKLYESFIEDYPIVSIEDPFDQDDWAHYAQFTATIGEKVQIV

Protein Length: 88

Fln nts: TTATTGAAGATTGCCATTGAGAAAGCAGGGTATACTGGCAAGGTTGTTATTGGTATGGATGTAGCTGCTTCTGAGTTTTATAAGTATGATTTGAACAATAATAATGGTAGCCAGAAGATATCAGGATCTGAGCTGATCAAGCTTTACGAATCGTTTATTGAGGATTATCCAATTGTATCTATAGAGGACCCATTTGATCAAGATGATTGGGCTCACTATGCACAATTTACGGCGACAATTGGGGAAAAGGTGCAAATTGTTGG

Fln Alignment:

biogeco3_euler_597___LLKIAIEKAGYTGKVVIGMDVAASEFY-----KYDLN----NNNGSQKISGSELIKLYESFIEDYPIVSIEDPFDQDDWAHYAQFTATIGEKVQIV
C0PQ35________________LLKIAIEKAGYTGKVVIGMDVAASEFYTEKDQKYDLNFKEENNNGSQKISGSELIKLYESFIEDYPIVSIEDPFDQDDWAHYAQFTATIGEKVQIV

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain