UniGene Name: sp_v3.0_unigene208020
Length: 246 nt
UniGene Fasta |
---|
>sp_v3.0_unigene208020
C |
Ace file of the UniGene sp_v3.0_unigene208020 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Thioredoxin H-type n=5 Tax=Picea RepID=TRXH_PICMA | - | - | 4.0e-30 | 87% |
FL-Next | sp=Thioredoxin; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 100% |
Sma3 | Thioredoxin h | - | - | 2.062e-14 | - |
Source | Gene names |
---|---|
Sma3 | At1g19730; At1g19730/F14P1_32; F14P1.32; F6F9.21; GSVIVT00014532001; GSVIVT00014535001; GSVIVT00036859001; OsI_024260; PHYPADRAFT_137251; PHYPADRAFT_185663; PHYPADRAFT_204594; POPTRDRAFT_219472; POPTRDRAFT_559783; POPTRDRAFT_710146; POPTRDRAFT_818765; Ptr |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | cytosol | GO:0005829 | Cellular Component | 0.0 | - |
Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
Sma3 | protein disulfide oxidoreductase activity | GO:0015035 | Molecular Function | 0.0 | - |
Sma3 | oxidoreductase activity, acting on a sulfur group of donors, disulfide as acceptor | GO:0016671 | Molecular Function | 0.0 | - |
Sma3 | glycerol ether metabolic process | GO:0006662 | Biological Process | 0.0 | - |
Sma3 | transport | GO:0006810 | Biological Process | 0.0 | - |
Sma3 | electron transport chain | GO:0022900 | Biological Process | 0.0 | - |
Sma3 | cell redox homeostasis | GO:0045454 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Thioredoxin | IPR005746 | - | 0.0 | - |
Sma3 | IPR006662 | - | 0.0 | - | |
Sma3 | IPR012335 | - | 0.0 | - | |
Sma3 | Thioredoxin domain | IPR013766 | - | 0.0 | - |
Sma3 | IPR015467 | - | 0.0 | - | |
Sma3 | IPR017936 | - | 0.0 | - | |
Sma3 | Thioredoxin, conserved site | IPR017937 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G51030.1 | ATTRX1, ATTRX H1, TRX1 thioredoxin H-type 1 chr3:18951123-18951955 REVERSE LENGTH=114 | 6.0e-19 | 54% |
RefSeq | Arabidopsis thaliana | NP_190672.1 | thioredoxin H1 [Arabidopsis thaliana] | 7.0e-19 | 54% |
RefSeq | Populus trichocarpa | XP_002307687.1 | thioredoxin h [Populus trichocarpa] | 2.0e-22 | 68% |
Full-Lengther Next Prediction |
---|
Fln status: Putative N-terminus
Fln database: coniferopsida.fasta
Fln subject: A9NRK1
Fln msg: Warning!, your query overlaps and the subject is separated, Distance to subject end: 17 aas, atg_distance in limit (1-15): atg_distance = 10, W2: There is no M at the beginning, your sequence is shorter than subject: 82 - 120
Fln protein:
H
Protein Length:
83
Fln nts:
C
Fln Alignment:
biogeco1_euler_31566___HSTEAWRSKLQEAIDTKRLVVVDFTAxxxxxxxLISLLFVELSKKFSEIFFLKVDVDELRDVAQEWDVEAMPTFIFIKDGKAVDKFVGANK
A9NRK1________________HSTEAWRSKLQEAIDTKRLVVVDFTAxxxxxxxVIGPVFVELSKKFPEIFFLKVDVDQLRDVAQEWDVEAMPTFIFIKDGKAVDKVVGAKK
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain