SustainPineDB

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene207119

Length: 901 nt

UniGene Fasta

Ace file of the UniGene sp_v3.0_unigene207119

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	rve domain containing protein	-	-	2.0e-15	44%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	37%
Sma3	Retrotransposon protein, putative, Ty1-copia subclass	-	-	8.155e-12	-

Source	Gene names
Sma3	AT4g04380; AT4g21360; At2g07550; At2g13930; At2g15700; At2g21460; F11I4_21; F28L22.3; F9K21.100; GSVIVT00006382001; GSVIVT00019821001; LOC_Os03g26290; LOC_Os03g27910; LOC_Os03g46450; LOC_Os10g01450; LOC_Os10g18420; LOC_Os11g17390; LOC_Os11g23750; LOC_Os12

Source	GOs	Term	Type	Identity
Sma3	nucleus	GO:0005634	Cellular Component	-
Sma3	membrane	GO:0016020	Cellular Component	-
Sma3	intrinsic to membrane	GO:0031224	Cellular Component	-
Sma3	apoplast	GO:0048046	Cellular Component	-
Sma3	nucleotide binding	GO:0000166	Molecular Function	-
Sma3	DNA binding	GO:0003677	Molecular Function	-
Sma3	sequence-specific DNA binding transcription factor activity	GO:0003700	Molecular Function	-
Sma3	RNA-directed DNA polymerase activity	GO:0003964	Molecular Function	-
Sma3	aspartic-type endopeptidase activity	GO:0004190	Molecular Function	-
Sma3	endonuclease activity	GO:0004519	Molecular Function	-
Sma3	transmembrane signaling receptor activity	GO:0004888	Molecular Function	-
Sma3	protein binding	GO:0005515	Molecular Function	-
Sma3	ATP binding	GO:0005524	Molecular Function	-
Sma3	zinc ion binding	GO:0008270	Molecular Function	-
Sma3	nucleoside-triphosphatase activity	GO:0017111	Molecular Function	-
Sma3	manganese ion binding	GO:0030145	Molecular Function	-
Sma3	nutrient reservoir activity	GO:0045735	Molecular Function	-
Sma3	regulation of transcription, DNA-dependent	GO:0006355	Biological Process	-
Sma3	apoptotic process	GO:0006915	Biological Process	-
Sma3	signal transduction	GO:0007165	Biological Process	-
Sma3	DNA integration	GO:0015074	Biological Process	-
Sma3	transposition	GO:0032196	Biological Process	-
Sma3	innate immune response	GO:0045087	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Toll/interleukin-1 receptor homology (TIR) domain	IPR000157	-	-
Sma3	Peptidase, cysteine peptidase active site	IPR000169	-	-
Sma3	Peptidase S8/S53, subtilisin/kexin/sedolisin	IPR000209	-	-
Sma3	CCAAT-binding transcription factor, subunit B	IPR001289	-	-
Sma3	Integrase, catalytic core	IPR001584	-	-
Sma3	Leucine-rich repeat	IPR001611	-	-
Sma3	Pleckstrin homology domain	IPR001849	-	-
Sma3	Zinc finger, CCHC-type	IPR001878	-	-
Sma3	Germin	IPR001929	-	-
Sma3	DNA methylase, N-6 adenine-specific, conserved site	IPR002052	-	-
Sma3	NB-ARC	IPR002182	-	-
Sma3	AAA+ ATPase domain	IPR003593	-	-
Sma3	Cupin 1	IPR006045	-	-
Sma3	Zinc finger, PMZ-type	IPR006564	-	-
Sma3	Zinc finger, SWIM-type	IPR007527	-	-
Sma3	Leucine-rich repeat 3	IPR011713	-	-
Sma3		IPR013084	-	-
Sma3	Reverse transcriptase, RNA-dependent DNA polymerase	IPR013103	-	-
Sma3	ABC-2 type transporter	IPR013525	-	-
Sma3	RmlC-like jelly roll fold	IPR014710	-	-
Sma3	Peptidase A2A, retrovirus RVP subgroup	IPR018061	-	-
Sma3	Germin, manganese binding site	IPR019780	-	-

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: B8LKX7

Fln msg: Overlapping hits, possible frame ERROR between 447 and 354, Unexpected STOP codon at 3' end. Distance to subject end: 59 aas, your sequence is shorter than subject: 267 - 407

Fln protein: GENVGTLYLCNGISNFVNDLTSTGEGMTLWHHRLGYISEKEM*ILHSRNLLPGLKHVDLKFCENCVYGK*KRVRFLRVGKEKKSGKLELVHTDVWGPAQVSSLGGSRYYVTFIDDATxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxKCLRSDNGGEYCSKEFDRYCSENGIRREKTFPGTPQENGVSERMNKTIMERARCMRLHAGLPLQFWADAVDTAVYLINRGPSSSLDVGIPEESWTSKKIEQSLRQNQRNVPLLDRC*

Protein Length: 268

Fln nts: GGAGAAAATGTTGGTACATTGTATTTATGCAATGGTATTTCTAATTTTGTTAATGATTTAACCTCTACAGGTGAAGGTATGACATTGTGGCATCATAGGCTTGGATACATCAGTGAGAAAGAGATGTAGATTCTTCACTCAAGAAATTTGTTGCCAGGTTTGAAGCATGTTGATTTAAAATTCTGTGAGAATTGTGTTTATGGAAAATAGAAGAGAGTCAGATTCCTTAGAGTTGGGAAAGAAAAGAAGAGCGGAAAATTAGAGCTTGTGCATACAGATGTATGGGGACCTGCTCAGGTATCATCTCTTGGTGGCTCTCGTTATTATGTTACTTTTATTGATGATGCAACCxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxAAGTGTCTCAGATCAGACAATGGAGGTGAATATTGCAGCAAAGAGTTTGATAGGTATTGTTCAGAGAATGGAATTCGTAGAGAGAAGACATTTCCAGGAACACCACAAGAAAATGGTGTGTCAGAAAGGATGAACAAGACAATCATGGAGCGTGCAAGGTGCATGAGATTGCATGCAGGATTGCCTTTACAATTTTGGGCAGATGCTGTAGATACTGCGGTTTATCTAATAAACAGAGGGCCTTCAAGTTCCTTGGATGTTGGTATTCCAGAGGAGTCATGGACAAGTAAGAAAATAGAACAAAGCTTGCGGCAAAATCAAAGAAATGTACCTTTATTGGATAGGTGTTAATGATTTTGGTTATCACTTTTATGATTATGAAAAACACAAAATCGTTAGGAGCATAGATGTCATATTCAATGAAAAGGTTTGGTTTAAGGATCAACTACAGG

Fln Alignment:

AllPine_b_rep_c69494___LWHHRLGYISEKEM*ILHSRNLLPGLKHVDLK--FCENCVYGK*KRVRFLRVGKEKKSGKLELVHTDVWGPAQVSSLGGSRYYVTFIDDATRKTWIYCIxxxxxxxxxxxxxxxxxxxxxxxx*K*DMKKLKCLRSDNGGEYCSKEFDRYCSENGIRREKTFPGTPQENGVSERMNKTIMERARCMRLHAGLPLQFWADAVDTAVYLINRGPSSSLDVGIPEESWTSKK
B8LKX7________________LWHERMGHLNYKSLSLMKRFEMVYGLPKISQSQGVCEGCMSGKQHMEKFIKGKSWRAKTPLHLVHSDLMGPLEHPSISGSRYVLTFIDDYSRRIWVYFLxxxxxxxxxxxxxxxxxxxxxxxxEKQSGKSIKILRTDNGKEYVNKEFDHYCKYNGIKREHTVPYTPQQNGVAERKNRTLMEMARCMLHARNMDPKFWAEAINTATYIVNRTPTIAVKHKTPEEAWSRRK

SNPs (tot: 52)

Position	A %	C %	G %	T %	Probability
263			66	33	0.997452
278	50		50		1.0
291		50	25	25	0.995595
298			66	33	0.997452
307	33			66	0.997452
316	12	87			0.992555
318		85		14	0.993533
321	50		50		1.0
325		14		85	0.993533
328		14		85	0.993533
339		14		85	0.993533
341	14		85		0.993533
348		87		12	0.992555
350	87		12		0.992554
352		85		14	0.993533
354	14		71		0.984337
361		71		28	1.0
363	42		57		1.0
377		80		20	0.995495
389	20		80		0.995497
390	75		25		0.996473
415		33	66		0.997452
419	25		50	25	0.995556
424	33		66		0.997452
428			75	25	0.996479
438		50	25	25	0.995595
439	66		33		0.997452
440	33		33	33	0.997751
441	33		66		0.997454
442	66	33			0.997476
448		33	33		0.997753
460		66	33		0.997459
492	66		33		0.997476
508	33	33		33	0.997584
514	66			33	0.997476
515	66		33		0.999997
517			66	33	0.997456
518	66	33			0.997455
522	33		66		0.997464
528	66		33		0.999999
586	75		25		0.996473
589	75		25		0.996473
619			75	25	0.996473
630	25		75		0.996473
635	66		33		1.0
640	33			66	0.997464
646		66		33	1.0
668		80		20	0.995493
671	20	80			0.995493
672			60	40	1.0
687		80		20	0.995493
713			25	75	0.996473

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain