UniGene Name: sp_v3.0_unigene195707
Length: 207 nt
UniGene Fasta |
---|
>sp_v3.0_unigene195707
G |
Ace file of the UniGene sp_v3.0_unigene195707 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Glutathione S-transferase-like protein n=13 Tax=Picea sitchensis RepID=C0PR46_PICSI | - | - | 2.0e-20 | 74% |
FL-Next | tr=Glutathione S-transferase-like protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 74% |
Sma3 | Glutathione S-transferase | - | - | 2.484e-14 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Glutathione transferase. | EC:2.5.1.18 | - | 2.722e-18 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Glutathione metabolism | 00480 | 2.722e-18 | % | |
Sma3 | Metabolism of xenobiotics by cytochrome P450 | 00980 | 2.722e-18 | % | |
Sma3 | Drug metabolism - cytochrome P450 | 00982 | 2.722e-18 | % |
Source | Gene names |
---|---|
Sma3 | At2g30860; At2g30870; At2g47730; B67C16.10; ERD13; F17A22.12; F7F1.8; GST1; GST3; GST6; GSVIVT00018860001; GSVIVT00018861001; GSVIVT00023502001; GSVIVT00023540001; GSVIVT00023541001; OJ1504_G04.2; Os05g0148900; PHYPADRAFT_183533; POPTRDRAFT_678517; POPTRD |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | chloroplast stroma | GO:0009570 | Cellular Component | 0.0 | - |
Sma3 | thylakoid | GO:0009579 | Cellular Component | 0.0 | - |
Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
Sma3 | glutathione transferase activity | GO:0004364 | Molecular Function | 0.0 | - |
Sma3 | glutathione peroxidase activity | GO:0004602 | Molecular Function | 0.0 | - |
Sma3 | copper ion binding | GO:0005507 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | transferase activity | GO:0016740 | Molecular Function | 0.0 | - |
Sma3 | glutathione binding | GO:0043295 | Molecular Function | 0.0 | - |
Sma3 | toxin catabolic process | GO:0009407 | Biological Process | 0.0 | - |
Sma3 | response to cold | GO:0009409 | Biological Process | 0.0 | - |
Sma3 | response to water deprivation | GO:0009414 | Biological Process | 0.0 | - |
Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
Sma3 | defense response to bacterium | GO:0042742 | Biological Process | 0.0 | - |
Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Zinc finger, CCHC-type | IPR001878 | - | 0.0 | - |
Sma3 | Glutathione S-transferase, N-terminal | IPR004045 | - | 0.0 | - |
Sma3 | Glutathione S-transferase, C-terminal | IPR004046 | - | 0.0 | - |
Sma3 | Glutathione S-transferase, C-terminal-like | IPR010987 | - | 0.0 | - |
Sma3 | IPR012335 | - | 0.0 | - | |
Sma3 | Glutathione S-transferase/chloride channel, C-terminal | IPR017933 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT2G30870.1 | ATGSTF10, ERD13, ATGSTF4, GSTF10 glutathione S-transferase PHI 10 chr2:13141490-13142392 FORWARD LENGTH=215 | 6.0e-23 | 65% |
RefSeq | Arabidopsis thaliana | NP_180644.1 | glutathione S-transferase ERD13 [Arabidopsis thaliana] | 7.0e-23 | 65% |
RefSeq | Populus trichocarpa | XP_002327563.1 | predicted protein [Populus trichocarpa] | 9.0e-21 | 62% |
Full-Lengther Next Prediction |
---|
Fln status: Putative C-terminus
Fln database: coniferopsida.fasta
Fln subject: E0Z842
Fln msg: STOP codon was not found. Distance to subject end: 8 aas, your sequence is shorter than subject: 68 - 211
Fln protein:
D
Protein Length:
69
Fln nts:
G
Fln Alignment:
AllPine_b_c35488___NVEKLSKVLDVYEKRLSKSEHLAGDFYSLADLHHLPFLHCLVNLVGKGHLISSRQHVNAWYHRISS
E0Z842________________NVEKLEKVLDIYEERLSKSKYLAGDFFSLADLQHLPCTHYLVNACGKGDLISSRKHVNAWWEDISS
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain