UniGene Name: sp_v3.0_unigene190677
Length: 227 nt
![]() |
---|
>sp_v3.0_unigene190677
C |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Probable mannitol dehydrogenase n=2 Tax=Fragaria x ananassa RepID=MTDH_FRAAN | - | - | 5.0e-13 | 71% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 84% |
Sma3 | Cinnamyl alcohol dehydrogenase | - | - | 8.922e-28 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Cinnamyl-alcohol dehydrogenase. | EC:1.1.1.195 | - | 4.482e-36 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Phenylpropanoid biosynthesis | 00940 | 4.482e-36 | % | |
Sma3 | Biosynthesis of phenylpropanoids | 01061 | 4.482e-36 | % | |
Sma3 | Metabolic pathways | 01100 | 4.482e-36 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 4.482e-36 | % | |
Sma3 | Mannitol dehydrogenase. | EC:1.1.1.255 | - | 6.689e-31 | - |
Source | Gene names |
---|---|
Sma3 | AT2G21730; AT2G21890; AT4G37970; AT4G37980; AT4g37970; At2g21730; At2g21890; At4g34230; At4g37970; At4g37980; At4g37990; BM1; CAD; CAD1; CAD14; CAD19; CAD2; CAD3; CAD5; CAD6; CAD7; CAD8; CADL10; CADL11; CADL4; CADL8; CADL9; ELI3; ELI3-1; ELI3-2; F20D10.10 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
Sma3 | cinnamyl-alcohol dehydrogenase activity | GO:0045551 | Molecular Function | 0.0 | - |
Sma3 | mannitol dehydrogenase activity | GO:0046029 | Molecular Function | 0.0 | - |
Sma3 | response to bacterium | GO:0009617 | Biological Process | 0.0 | - |
Sma3 | lignin biosynthetic process | GO:0009809 | Biological Process | 0.0 | - |
Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Alcohol dehydrogenase superfamily, zinc-type | IPR002085 | - | 0.0 | - |
Sma3 | Alcohol dehydrogenase, zinc-type, conserved site | IPR002328 | - | 0.0 | - |
Sma3 | Alcohol dehydrogenase, C-terminal | IPR013149 | - | 0.0 | - |
Sma3 | Alcohol dehydrogenase GroES-like | IPR013154 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT2G21890.1 | CAD3, ATCAD3 cinnamyl alcohol dehydrogenase homolog 3 chr2:9331089-9332646 FORWARD LENGTH=375 | 1.0e-16 | 70% |
RefSeq | Arabidopsis thaliana | NP_179780.1 | cinnamyl alcohol dehydrogenase 3 [Arabidopsis thaliana] | 2.0e-16 | 70% |
RefSeq | Populus trichocarpa | XP_002300400.1 | cinnamyl alcohol dehydrogenase-like protein [Populus trichocarpa] | 1.0e-17 | 78% |
![]() |
---|
Fln status: N-terminus
Fln database: coniferopsida.fasta
Fln subject: A9NZE7
Fln msg: Distance to subject end: 307 aas, your sequence is shorter than subject: 53 - 364
Fln protein:
M
Protein Length:
54
Fln nts:
C
Fln Alignment:
AllPine_b_c28447___GRFNVE--GWAARDESGILSPFNFTRRNTGPHDVTLKIAYCGICHSDLHQ
A9NZE7________________GRFEVEVEGWAAKDESGILSPFNFTRRKTGSHDVTFKVAYCGICHSDLHQ
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain