|
||||||
|
UniGene Name: sp_v3.0_unigene188760
Length: 243 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene188760
C |
|
Ace file of the UniGene sp_v3.0_unigene188760
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Cytochrome P450 n=1 Tax=Centaurium erythraea RepID=Q6PLI3_9GENT | - | - | 1.0e-23 | 61% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 82% |
| Sma3 | Flavonoid 3'-hydroxylase | - | - | 0.0 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | EC:1.14.-.- | - | 2.623e-07 | - | |
| Sma3 | Flavonoid 3'-monooxygenase. | EC:1.14.13.21 | - | 1.209e-09 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Flavonoid biosynthesis | 00941 | 1.209e-09 | % | |
| Sma3 | Flavone and flavonol biosynthesis | 00944 | 1.209e-09 | % | |
| Sma3 | Biosynthesis of phenylpropanoids | 01061 | 1.209e-09 | % | |
| Sma3 | Metabolic pathways | 01100 | 1.209e-09 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 1.209e-09 | % |
| Source | Gene names |
|---|---|
| Sma3 | AT4g12300; AT4g12320; At2g40890; At2g45550; At2g45560; At2g45570; At4g12300; At4g12300/T4C9_140; At4g12320; At5g07990; C3H2; C3H3; CYP706C5; CYP736A3v2; CYP736A4v1; CYP736A5v1; CYP736A6Pv1; CYP736A8v1; CYP736A8v2; CYP736A9; CYP75; CYP75B1; CYP75B2; CYP76C |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
| Sma3 | endoplasmic reticulum | GO:0005783 | Cellular Component | 0.0 | - |
| Sma3 | endoplasmic reticulum membrane | GO:0005789 | Cellular Component | 0.0 | - |
| Sma3 | microsome | GO:0005792 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | monooxygenase activity | GO:0004497 | Molecular Function | 0.0 | - |
| Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
| Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
| Sma3 | flavonoid 3'-monooxygenase activity | GO:0016711 | Molecular Function | 0.0 | - |
| Sma3 | heme binding | GO:0020037 | Molecular Function | 0.0 | - |
| Sma3 | p-coumarate 3-hydroxylase activity | GO:0046409 | Molecular Function | 0.0 | - |
| Sma3 | coumarin biosynthetic process | GO:0009805 | Biological Process | 0.0 | - |
| Sma3 | lignin biosynthetic process | GO:0009809 | Biological Process | 0.0 | - |
| Sma3 | flavonoid biosynthetic process | GO:0009813 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Cytochrome P450 | IPR001128 | - | 0.0 | - |
| Sma3 | Aminoacyl-tRNA synthetase, class I, conserved site | IPR001412 | - | 0.0 | - |
| Sma3 | Cytochrome P450, E-class, group I | IPR002401 | - | 0.0 | - |
| Sma3 | Cytochrome P450, E-class, group IV | IPR002403 | - | 0.0 | - |
| Sma3 | Cytochrome P450, conserved site | IPR017972 | - | 0.0 | - |
| Sma3 | IPR017973 | - | 0.0 | - | |
| Sma3 | EF-Hand 1, calcium-binding site | IPR018247 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT2G45570.1 | CYP76C2 cytochrome P450, family 76, subfamily C, polypeptide 2 chr2:18779935-18781922 REVERSE LENGTH=512 | 3.0e-27 | 57% |
| RefSeq | Arabidopsis thaliana | NP_182081.1 | cytochrome P450 76C2 [Arabidopsis thaliana] | 4.0e-27 | 57% |
| RefSeq | Populus trichocarpa | XP_002334744.1 | cytochrome P450, partial [Populus trichocarpa] | 2.0e-27 | 58% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LKD2
Fln msg: Distance to subject end: 121 aas, your sequence is shorter than subject: 80 - 441
Fln protein:
T
Protein Length:
81
Fln nts:
C
Fln Alignment:
AllPine_b_c21967___TTATTIEWAMAELIRNPEKMKRAQAELDEVVGRDRMVDESDAERLPFLRAVVKEVFRLHPAVPLLIPHRSDGSCEIEGFV
B8LKD2________________TTATTIEWAMTELIRNPEKMKRVQAELEEVVGRERMVEESDTERLPYLRAVVKEVLRLHPAAPFLIPHRADNRCEIAGFV
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
