UniGene Name: sp_v3.0_unigene188701
Length: 174 nt
![]() |
---|
>sp_v3.0_unigene188701
C |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | elongation factor Ts family protein [Arabidopsis thaliana] emb|CAB43920.1| putative protein [Arabidopsis thaliana] emb|CAB79664.1| putative protein [Arabidopsis thaliana] gb|AAL10483.1| AT4g29060/F19B15_90 [Arabidopsis thaliana] gb|AEE85580.1| elongation | - | - | 8.0e-20 | 82% |
FL-Next | sp=Elongation factor Ts, chloroplastic; Rhodomonas salina (Cryptomonas salina). Plastid; Chloroplast. | - | - | 0.0 | 65% |
Sma3 | Elongation factor Ts | - | - | 2.52e-29 | - |
Source | Gene names |
---|---|
Sma3 | AT4g29060; At4g29060; CHLREDRAFT_195617; EFT1c|EFT1b|EFT1a; F19B15.90; GSVIVT00016703001; Grc000140; LOC_Os12g35630; MICPUCDRAFT_51502; MICPUN_55643; MICPUN_80283; OSTLU_49408; Os12g0541500; OsI_38621; OsJ_36392; PHYPADRAFT_129127; PHYPADRAFT_21938; POPTR |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | chloroplast stroma | GO:0009570 | Cellular Component | 0.0 | - |
Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
Sma3 | translation elongation factor activity | GO:0003746 | Molecular Function | 0.0 | - |
Sma3 | translational elongation | GO:0006414 | Biological Process | 0.0 | - |
Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Ubiquitin-associated/translation elongation factor EF1B, N-terminal | IPR000449 | - | 0.0 | - |
Sma3 | Translation elongation factor EFTs/EF1B | IPR001816 | - | 0.0 | - |
Sma3 | Ribosomal protein S1, RNA-binding domain | IPR003029 | - | 0.0 | - |
Sma3 | Nucleic acid-binding, OB-fold | IPR012340 | - | 0.0 | - |
Sma3 | Translation elongation factor EFTs/EF1B, dimerisation | IPR014039 | - | 0.0 | - |
Sma3 | Ubiquitin-associated/translation elongation factor EF1B, N-terminal, eukaryote | IPR015940 | - | 0.0 | - |
Sma3 | Translation elongation factor Ts, conserved site | IPR018101 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G29060.1 | emb2726 elongation factor Ts family protein chr4:14317744-14321315 FORWARD LENGTH=953 | 2.0e-25 | 82% |
RefSeq | Arabidopsis thaliana | NP_567820.1 | elongation factor Ts family protein [Arabidopsis thaliana] | 3.0e-25 | 82% |
RefSeq | Populus trichocarpa | XP_002325009.1 | predicted protein, partial [Populus trichocarpa] | 7.0e-26 | 82% |
![]() |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: A6MVX0
Fln msg: Distance to subject end: 134 aas, your sequence is shorter than subject: 57 - 219
Fln protein:
L
Protein Length:
58
Fln nts:
C
Fln Alignment:
AllPine_b_c21836___LTETAGDLVKAQEFLRKKGLASADKKSGRIAAEGRVGSYIH-DNRIGVLIEVNCETDF
A6MVX0________________LQESNGDFEQAMESLRKKGLASANKKSDRIATEGIIESYIHMGGKLGVLVEVNCETDF
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain