SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene183974

Length: 333 nt

UniGene Fasta

>sp_v3.0_unigene183974
ATTACTATGCTGCAAAGGATAGGCACTGGCATGTTTTTCTCCATTATATCAATGGTTGTTGCTGCATTGATAGAGATTAGAAGAATCGAGGTAGCAAAGGACAGTGGACTGATAGACCTGCCCAATGCAACAATTCCCTTGAGCATTTTTCTGCTGCTTCCACAATATGTGCTATTTGGCATAGCGGATGTATTTGCAATGGTAGGAATGCAATAGTATTTTTATGATCAGATGCCAGACACTATGAAAAGCTTAGGTATTGCTGTGTATCTGAGTGTTGTAGGAGTTTTCTAGTTTCATTAGCAGCATCCTTATTTCAATTACTGAGAAGCT

Ace file of the UniGene sp_v3.0_unigene183974

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Similar to peptide transporter [Arabidopsis thaliana]	-	-	3.0e-30	61%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	82%
Sma3	Chromosome chr18 scaffold_122, whole genome shotgun sequence	-	-	8.927e-27	-

Source	Gene names
Sma3	At1g22540; At1g22550; At1g72115; At1g72120; At1g72140; At2g37900; At3g01350; At5g46050; F12K8.11; F12K8.12; F28P5.2; F5K20_260; GSVIVT00001821001; GSVIVT00001823001; GSVIVT00001825001; GSVIVT00001827001; GSVIVT00001828001; GSVIVT00001829001; GSVIVT0000183

Source	GOs	Term	Type	Identity
Sma3	nucleus	GO:0005634	Cellular Component	-
Sma3	plasma membrane	GO:0005886	Cellular Component	-
Sma3	membrane	GO:0016020	Cellular Component	-
Sma3	integral to membrane	GO:0016021	Cellular Component	-
Sma3	sequence-specific DNA binding transcription factor activity	GO:0003700	Molecular Function	-
Sma3	transporter activity	GO:0005215	Molecular Function	-
Sma3	dipeptide transporter activity	GO:0042936	Molecular Function	-
Sma3	tripeptide transporter activity	GO:0042937	Molecular Function	-
Sma3	sequence-specific DNA binding	GO:0043565	Molecular Function	-
Sma3	regulation of transcription, DNA-dependent	GO:0006355	Biological Process	-
Sma3	oligopeptide transport	GO:0006857	Biological Process	-
Sma3	response to wounding	GO:0009611	Biological Process	-
Sma3	response to abscisic acid stimulus	GO:0009737	Biological Process	-
Sma3	response to salicylic acid stimulus	GO:0009751	Biological Process	-
Sma3	response to jasmonic acid stimulus	GO:0009753	Biological Process	-
Sma3	hyperosmotic salinity response	GO:0042538	Biological Process	-
Sma3	defense response to bacterium	GO:0042742	Biological Process	-
Sma3	dipeptide transport	GO:0042938	Biological Process	-
Sma3	tripeptide transport	GO:0042939	Biological Process	-
Sma3	response to leucine	GO:0043201	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Oligopeptide transporter	IPR000109	-	-
Sma3	Regulator of chromosome condensation, RCC1	IPR000408	-	-
Sma3	Legume lectin, alpha chain, conserved site	IPR000985	-	-
Sma3	Homeodomain	IPR001356	-	-
Sma3	POX	IPR006563	-	-
Sma3		IPR012287	-	-
Sma3	ABC transporter, conserved site	IPR017871	-	-
Sma3	Homeobox, conserved site	IPR017970	-	-
Sma3	PTR2 family proton/oligopeptide symporter, conserved site	IPR018456	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT1G22540.1	Major facilitator superfamily protein chr1:7964202-7966222 FORWARD LENGTH=557	2.0e-37	61%
RefSeq	Arabidopsis thaliana	NP_173670.2	putative peptide/nitrate transporter [Arabidopsis thaliana]	2.0e-37	61%
RefSeq	Populus trichocarpa	XP_002325970.1	predicted protein [Populus trichocarpa]	2.0e-36	63%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: B8LQ03

Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 64 aas, your sequence is shorter than subject: 98 - 573

Fln protein: ITMLQRIGTGMFFSIISMVVAALIEIRRIEVAKDSGLIDLPNATIPLSIFLLLPQYVLFGIADVFAMVGMQ*YFYDQMPDTMKSLGIAVYLSVVGVF*

Protein Length: 99

Fln nts: ATTACTATGCTGCAAAGGATAGGCACTGGCATGTTTTTCTCCATTATATCAATGGTTGTTGCTGCATTGATAGAGATTAGAAGAATCGAGGTAGCAAAGGACAGTGGACTGATAGACCTGCCCAATGCAACAATTCCCTTGAGCATTTTTCTGCTGCTTCCACAATATGTGCTATTTGGCATAGCGGATGTATTTGCAATGGTAGGAATGCAATAGTATTTTTATGATCAGATGCCAGACACTATGAAAAGCTTAGGTATTGCTGTGTATCTGAGTGTTGTAGGAGTTTTCTAGTTTCATTAGCAGCATCCTTATTTCAATTACTGAGAAGCT

Fln Alignment:

AllPine_b_c7922___ITMLQRIGTGMFFSIISMVVAALIEIRRIEVAKDSGLIDLPNATIPLSIFLLLPQYVLFGIADVFAMVGMQ*YFYDQMPDTMKSLGIAVYLSVVGV
B8LQ03________________ITFLQRIGTGMFISILSMIVAALAEIRRIKAAKDNGLIDMPKATIPLSISLLLPQYILFGLADVFTMVGMQEYFYDQMPDTMKTLGIAVYLSVLGV

SNPs (tot: 17)

Position	A %	C %	G %	T %	Probability
2			25	75	0.996474
3	33			66	0.997452
5	25	75			0.996479
6		25		25	0.995556
20	50		50		1.0
58	50		50		1.0
66		50		50	1.0
101	75		25		0.996486
107	50		50		1.0
129		50		50	1.0
214		50	50		1.0
218			50	50	1.0
220	33		66		0.997459
222	66			33	0.997458
224		33		33	0.997721
258		33		66	0.997476
277		33		66	0.997476

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain