UniGene Name: sp_v3.0_unigene168296
Length: 118 nt
UniGene Fasta |
---|
>sp_v3.0_unigene168296
A |
Ace file of the UniGene sp_v3.0_unigene168296 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Reverse transcriptase (Fragment) n=1 Tax=Morus bombycis RepID=Q9AVM8_9ROSA | - | - | 8.0e-09 | 78% |
FL-Next | tr=Putative uncharacterized protein; Vitis vinifera (Grape). | - | - | 0.0 | 68% |
Sma3 | Reverse transcriptase | - | - | 1.4013e-45 | - |
Source | Gene names |
---|---|
Sma3 | B1234D02.1; H0515C11.9; LOC_Os03g34190; LOC_Os03g39250; LOC_Os03g41770; LOC_Os03g41960; LOC_Os03g45550; LOC_Os03g48990; LOC_Os10g06170; LOC_Os10g06290; LOC_Os10g06330; LOC_Os10g06380; LOC_Os10g06450; LOC_Os10g09220; LOC_Os10g09400; LOC_Os10g09510; LOC_Os1 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | chromatin | GO:0000785 | Cellular Component | 0.0 | - |
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | chromatin binding | GO:0003682 | Molecular Function | 0.0 | - |
Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
Sma3 | chromatin assembly or disassembly | GO:0006333 | Biological Process | 0.0 | - |
Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
Sma3 | neuropeptide signaling pathway | GO:0007218 | Biological Process | 0.0 | - |
Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Reverse transcriptase | IPR000477 | - | 0.0 | - |
Sma3 | Chromo domain/shadow | IPR000953 | - | 0.0 | - |
Sma3 | Integrase, catalytic core | IPR001584 | - | 0.0 | - |
Sma3 | Zinc finger, CCHC-type | IPR001878 | - | 0.0 | - |
Sma3 | Peptidase aspartic, active site | IPR001969 | - | 0.0 | - |
Sma3 | Peptidase A2A, retrovirus, catalytic | IPR001995 | - | 0.0 | - |
Sma3 | Carbohydrate/puine kinase, PfkB, conserved site | IPR002173 | - | 0.0 | - |
Sma3 | FMRFamide-related peptide-like | IPR002544 | - | 0.0 | - |
Sma3 | Retrotransposon gag protein | IPR005162 | - | 0.0 | - |
Sma3 | Domain of unknown function DUF834 | IPR008552 | - | 0.0 | - |
Sma3 | Peptidase aspartic, catalytic | IPR009007 | - | 0.0 | - |
Sma3 | Retroviral aspartyl protease | IPR013242 | - | 0.0 | - |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: tr_plants
Fln subject: A5AY02
Fln msg: Distance to subject end: 59 aas, your sequence is shorter than subject: 38 - 127
Fln protein:
Q
Protein Length:
39
Fln nts:
A
Fln Alignment:
HIF1XHV03HDA6D___QMKGAAVFSKIDLRSGYH*LRIFESDISKTAFRTCFGH
A5AY02________________QLQGACVFSKIDLRSGYHQLRVRSEDVPKTAFRTKYGH
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain