|
||||||
|
UniGene Name: sp_v3.0_unigene168210
Length: 244 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene168210
C |
|
Ace file of the UniGene sp_v3.0_unigene168210
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Thaumatin-like protein (Fragment) n=12 Tax=Picea sitchensis RepID=E0ZCY0_PICSI | - | - | 7.0e-29 | 74% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 81% |
| Sma3 | Thaumatin-like protein | - | - | 0.0 | - |
| Source | Gene names |
|---|---|
| Sma3 | 5A1A.16; At1g75030; At1g75040; At1g75050; At4g11650; Cry j 3.1; Cry j 3.2; Cry j 3.3; Cry j 3.4; Cry j 3.5; Cry j 3.6; Cry j 3.7; Cry j 3.8; F25A4.1; F9E10.10; F9E10.11; F9E10.12; GSVIVT00001102001; GSVIVT00001103001; GSVIVT00001104001; GSVIVT00001105001; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | extracellular region | GO:0005576 | Cellular Component | 0.0 | - |
| Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
| Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
| Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
| Sma3 | monooxygenase activity | GO:0004497 | Molecular Function | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
| Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
| Sma3 | heme binding | GO:0020037 | Molecular Function | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | xenobiotic metabolic process | GO:0006805 | Biological Process | 0.0 | - |
| Sma3 | defense response | GO:0006952 | Biological Process | 0.0 | - |
| Sma3 | response to biotic stimulus | GO:0009607 | Biological Process | 0.0 | - |
| Sma3 | systemic acquired resistance | GO:0009627 | Biological Process | 0.0 | - |
| Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
| Sma3 | response to UV-B | GO:0010224 | Biological Process | 0.0 | - |
| Sma3 | regulation of anthocyanin biosynthetic process | GO:0031540 | Biological Process | 0.0 | - |
| Sma3 | defense response to fungus | GO:0050832 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
| Sma3 | Blue (type 1) copper domain | IPR000923 | - | 0.0 | - |
| Sma3 | Cytochrome P450 | IPR001128 | - | 0.0 | - |
| Sma3 | Thaumatin, pathogenesis-related | IPR001938 | - | 0.0 | - |
| Sma3 | Proteinase inhibitor I2, Kunitz metazoa | IPR002223 | - | 0.0 | - |
| Sma3 | Cytochrome P450, E-class, group I | IPR002401 | - | 0.0 | - |
| Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
| Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
| Sma3 | IPR017442 | - | 0.0 | - | |
| Sma3 | Thaumatin, conserved site | IPR017949 | - | 0.0 | - |
| Sma3 | IPR017973 | - | 0.0 | - | |
| Sma3 | Peptidase S1/S6, chymotrypsin/Hap, active site | IPR018114 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G75050.1 | Pathogenesis-related thaumatin superfamily protein chr1:28180116-28181062 FORWARD LENGTH=246 | 3.0e-24 | 62% |
| RefSeq | Arabidopsis thaliana | NP_177642.2 | pathogenesis-related thaumatin-like protein protein [Arabidopsis thaliana] | 3.0e-24 | 62% |
| RefSeq | Populus trichocarpa | XP_002325077.1 | predicted protein [Populus trichocarpa] | 5.0e-24 | 53% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9P146
Fln msg: Distance to subject end: 73 aas, your sequence is shorter than subject: 81 - 233
Fln protein:
C
Protein Length:
82
Fln nts:
C
Fln Alignment:
HIF1XHV03GG039___CSFDASGKGSCNTGDCGGLLSCQAAGRPPATLAEYTLNGDNGRDTYDMSLVDGFNLPLSITPXXXXXXXXXXXXNITASCP
A9P146________________CSFDASGQGSCNTGDCGGLLSCQVSGRPPATLAEYTLTGDNNLDTYDISLVDGFNLPLKITPSDTTCPTVDCSSNITANCP
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
