|
||||||
|
UniGene Name: sp_v3.0_unigene168042
Length: 130 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene168042
T |
|
Ace file of the UniGene sp_v3.0_unigene168042
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Os07g0132500 protein (Fragment) n=4 Tax=Oryza sativa RepID=Q0D8S4_ORYSJ | - | - | 1.0e-13 | 86% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 93% |
| Sma3 | Putative receptor-type protein kinase LRK1 | - | - | 6.976e-27 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Cyclin-dependent kinase. | EC:2.7.11.22 | - | 1.224e-06 | - |
| Source | Gene names |
|---|---|
| Sma3 | 117M18_32; AT4g02410; AT4g02420; AT4g28350; At1g15530; At2g37710; At3g08870; At3g53810; At4g02410; At4g02420; At4g28350; At5g01540; At5g01550; At5g01560; At5g59260; B1008E06.18; F20O9.40; F5K20_110; F7A7.60; F7A7.70; F7A7.80; GSVIVT00001297001; GSVIVT0000 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | cell surface | GO:0009986 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
| Sma3 | DNA-directed RNA polymerase activity | GO:0003899 | Molecular Function | 0.0 | - |
| Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
| Sma3 | protein kinase activity | GO:0004672 | Molecular Function | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
| Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | sugar binding | GO:0005529 | Molecular Function | 0.0 | - |
| Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
| Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
| Sma3 | GO:0006350 | Biological Process | 0.0 | - | |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | abscisic acid mediated signaling pathway | GO:0009738 | Biological Process | 0.0 | - |
| Sma3 | response to salicylic acid stimulus | GO:0009751 | Biological Process | 0.0 | - |
| Sma3 | seed germination | GO:0009845 | Biological Process | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT4G02410.1 | Concanavalin A-like lectin protein kinase family protein chr4:1060086-1062110 REVERSE LENGTH=674 | 2.0e-18 | 81% |
| RefSeq | Arabidopsis thaliana | NP_567233.1 | concanavalin A-like lectin kinase-like protein [Arabidopsis thaliana] | 3.0e-18 | 81% |
| RefSeq | Populus trichocarpa | XP_002308233.1 | predicted protein [Populus trichocarpa] | 4.0e-18 | 81% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LLJ6
Fln msg: Distance to subject end: 207 aas, your sequence is shorter than subject: 43 - 704
Fln protein:
V
Protein Length:
44
Fln nts:
T
Fln Alignment:
HIF1XHV03HDUZP___VAAGLLYLHEGWEKMVIHRDIKSSNVLLDSEHNGRLGDFGLAR
B8LLJ6________________VAAGLLYLHEQWEKRVIHRDIKSSNVLLDSELNGRLGDFGLAR
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
