|
||||||
|
UniGene Name: sp_v3.0_unigene167736
Length: 194 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene167736
C |
|
Ace file of the UniGene sp_v3.0_unigene167736
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Os08g0133100 protein n=2 Tax=Oryza sativa RepID=Q0J867_ORYSJ | - | - | 8.0e-14 | 58% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 44% |
| Sma3 | Retrotransposon protein, putative, Ty1-copia subclass | - | - | 3.285e-08 | - |
| Source | Gene names |
|---|---|
| Sma3 | H0512B01.3; H0512B01.8; LOC_Os10g12760; LOC_Os10g17570; LOC_Os10g41610; LOC_Os11g09330; LOC_Os11g44190; LOC_Os12g09260; LOC_Os12g10900; LOC_Os12g40060; OJ000114_01.9; OSJNBa0004A10.6; OSJNBa0011L09.17; OSJNBa0013D02.15; OSJNBa0027P10.24; OSJNBa0057L21.25; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | chromatin | GO:0000785 | Cellular Component | 0.0 | - |
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | endoplasmic reticulum membrane | GO:0005789 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | chromatin binding | GO:0003682 | Molecular Function | 0.0 | - |
| Sma3 | catalytic activity | GO:0003824 | Molecular Function | 0.0 | - |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | chromatin assembly or disassembly | GO:0006333 | Biological Process | 0.0 | - |
| Sma3 | GPI anchor biosynthetic process | GO:0006506 | Biological Process | 0.0 | - |
| Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Chromo domain/shadow | IPR000953 | - | 0.0 | - |
| Sma3 | Integrase, catalytic core | IPR001584 | - | 0.0 | - |
| Sma3 | Zinc finger, CCHC-type | IPR001878 | - | 0.0 | - |
| Sma3 | Ankyrin repeat | IPR002110 | - | 0.0 | - |
| Sma3 | Phosphotransferase system, HPr serine phosphorylation site | IPR002114 | - | 0.0 | - |
| Sma3 | HhH-GPD domain | IPR003265 | - | 0.0 | - |
| Sma3 | Retrotransposon gag protein | IPR005162 | - | 0.0 | - |
| Sma3 | GPI biosynthesis protein Pig-F | IPR009580 | - | 0.0 | - |
| Sma3 | IPR013084 | - | 0.0 | - | |
| Sma3 | Reverse transcriptase, RNA-dependent DNA polymerase | IPR013103 | - | 0.0 | - |
| Sma3 | Domain of unknown function DUF1785 | IPR014811 | - | 0.0 | - |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LKV8
Fln msg: Distance to subject end: 58 aas, your sequence is shorter than subject: 64 - 363
Fln protein:
H
Protein Length:
65
Fln nts:
C
Fln Alignment:
HIF1XHV03GPQKO___MEDCKPTPSPFQSGVKLSITCTSPEVDATLYRQLVGKLLYLTHTRPDLSFAVGLVARFMQNPR
B8LKV8________________MINCSPVSTPVGVGTKLSREQNEMDFDSTIFRKLVGSLMYLTATRPDIMYGVSLISRFMDTPK
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
