UniGene Name: sp_v3.0_unigene167713
Length: 227 nt
![]() |
---|
>sp_v3.0_unigene167713
G |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Os02g0712700 protein n=2 Tax=Oryza sativa Japonica Group RepID=Q0DY65_ORYSJ | - | - | 2.0e-19 | 67% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 59% |
Sma3 | Kinase, putative | - | - | 2.661e-29 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Non-specific protein-tyrosine kinase. | EC:2.7.10.2 | - | 1.151e-12 | - |
Sma3 | Cyclin-dependent kinase. | EC:2.7.11.22 | - | 3.188e-10 | - |
Sma3 | EC:2.7.11.3- | - | 9.389e-07 | - |
Source | Gene names |
---|---|
Sma3 | AT4g02410; AT4g02420; At2g32800; At2g32800/F24L7.6; At2g37710; At3g53380; At3g53810; At4g02410; At4g02420; At5g01540; At5g01560; At5g03140; At5g42120; At5g55830; At5g65600; F15A17_170; F4P12_80; F5K20_110; F7A7.60; F7A7.80; GSVIVT00001297001; GSVIVT000012 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | chromatin | GO:0000785 | Cellular Component | 0.0 | - |
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | cell surface | GO:0009986 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | chromatin binding | GO:0003682 | Molecular Function | 0.0 | - |
Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
Sma3 | copper ion binding | GO:0005507 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | sugar binding | GO:0005529 | Molecular Function | 0.0 | - |
Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
Sma3 | chromatin assembly or disassembly | GO:0006333 | Biological Process | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
Sma3 | abscisic acid mediated signaling pathway | GO:0009738 | Biological Process | 0.0 | - |
Sma3 | response to salicylic acid stimulus | GO:0009751 | Biological Process | 0.0 | - |
Sma3 | seed germination | GO:0009845 | Biological Process | 0.0 | - |
Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G55830.1 | Concanavalin A-like lectin protein kinase family protein chr5:22594655-22596700 FORWARD LENGTH=681 | 7.0e-23 | 65% |
RefSeq | Arabidopsis thaliana | NP_200394.1 | concanavalin A-like lectin kinase-like protein [Arabidopsis thaliana] | 1.0e-22 | 65% |
RefSeq | Populus trichocarpa | XP_002338810.1 | predicted protein, partial [Populus trichocarpa] | 8.0e-25 | 66% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NVC0
Fln msg: Distance to subject end: 120 aas, your sequence is shorter than subject: 75 - 636
Fln protein:
D
Protein Length:
76
Fln nts:
G
Fln Alignment:
HIF1XHV01BOTRJ___LNWERRYNIVSGVASALLYLHEECEQQVIHRDVKASNIMLDSEYKARLGDFGLARLIELDRRSFTT
A9NVC0________________LPWHRRYAILKGVAAGLLYLHEQWEKRVVHRDIKSSNVLLDSELNGRLGDFGLARLYDHAENPETT
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain