UniGene Name: sp_v3.0_unigene167702
Length: 189 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene167702
C |
Ace file of the UniGene sp_v3.0_unigene167702
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | protein kinase-like protein [Arabidopsis thaliana] gb|AAD21431.1| putative protein kinase [Arabidopsis thaliana] gb|AEC09236.1| protein kinase-like protein [Arabidopsis thaliana] | - | - | 1.0e-11 | 60% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 60% |
| Source | Gene names |
|---|---|
| Sma3 | At1g53700; At3g14370; F22G10.21; GSVIVT00028378001; H0321H01.14; LOC_Os11g01140; LOC_Os12g01140; OSJNBa0089K24.26-1; OSJNBa0089K24.26-2; Os01g0174700; Os11g0102200; Os12g0101800; OsI_15794; OsI_37115; OsJ_14710; OsJ_32634; Osnph1a; PHOTA2; PHYPADRAFT_8916 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | two-component sensor activity | GO:0000155 | Molecular Function | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | two-component signal transduction system (phosphorelay) | GO:0000160 | Biological Process | 0.0 | - |
| Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | auxin polar transport | GO:0009926 | Biological Process | 0.0 | - |
| Sma3 | root development | GO:0048364 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | PAS | IPR000014 | - | 0.0 | - |
| Sma3 | PAS-associated, C-terminal | IPR000700 | - | 0.0 | - |
| Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
| Sma3 | PAC motif | IPR001610 | - | 0.0 | - |
| Sma3 | Serine/threonine- / dual-specificity protein kinase, catalytic domain | IPR002290 | - | 0.0 | - |
| Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
| Sma3 | PAS fold-3 | IPR013655 | - | 0.0 | - |
| Sma3 | PAS fold | IPR013767 | - | 0.0 | - |
| Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
| Sma3 | IPR017442 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT2G36350.1 | Protein kinase superfamily protein chr2:15238903-15241864 FORWARD LENGTH=949 | 8.0e-16 | 60% |
| RefSeq | Arabidopsis thaliana | NP_181176.1 | protein kinase-like protein [Arabidopsis thaliana] | 1.0e-15 | 60% |
| RefSeq | Populus trichocarpa | XP_002300477.1 | predicted protein [Populus trichocarpa] | 7.0e-16 | 64% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NVL2
Fln msg: Distance to subject end: 23 aas, your sequence is shorter than subject: 63 - 506
Fln protein:
L
Protein Length:
64
Fln nts:
C
Fln Alignment:
HIF1XHV01BWME8___LMHRLLTKDPRTRLGSTRGSADIKAHPFFKGINWPLIRSTVPPEIP
A9NVL2________________LIKGLLAKGPQHRLGSRRGATEIKQHPFFEGVNWALIRSITPPEVP

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta