|
||||||
|
UniGene Name: sp_v3.0_unigene167413
Length: 213 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene167413
C |
|
Ace file of the UniGene sp_v3.0_unigene167413
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Pentatricopeptide repeat-containing protein, putative n=1 Tax=Ricinus communis RepID=B9S079_RICCO | - | - | 1.0e-20 | 66% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 78% |
| Sma3 | Pentatricopeptide, putative | - | - | 1.029e-07 | - |
| Source | Gene names |
|---|---|
| Sma3 | At1g06140; At1g15510; At1g20230; At1g74600; At1g74630; At2g22070; At3g11460; At4g02750; At4g16835; At4g21300; At5g08510; At5g59600; At5g66520; B1032F05.19; DYW10; F1M20.28; F1M20.31; F24K9.13; F2O15.13; F8L15.21; FCAALL.441; GSVIVT00000138001; GSVIVT00000 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
| Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | ubiquitin thiolesterase activity | GO:0004221 | Molecular Function | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | deaminase activity | GO:0019239 | Molecular Function | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | ubiquitin-dependent protein catabolic process | GO:0006511 | Biological Process | 0.0 | - |
| Sma3 | purine ribonucleoside monophosphate biosynthetic process | GO:0009168 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Armadillo | IPR000225 | - | 0.0 | - |
| Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
| Sma3 | Beta-lactamase, class-A/D | IPR000871 | - | 0.0 | - |
| Sma3 | Adenosine/AMP deaminase domain | IPR001365 | - | 0.0 | - |
| Sma3 | Peptidase C12, ubiquitin carboxyl-terminal hydrolase 1 | IPR001578 | - | 0.0 | - |
| Sma3 | Pentatricopeptide repeat | IPR002885 | - | 0.0 | - |
| Sma3 | Immunoglobulin/major histocompatibility complex, conserved site | IPR003006 | - | 0.0 | - |
| Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
| Sma3 | Armadillo-like helical | IPR011989 | - | 0.0 | - |
| Sma3 | Tetratricopeptide-like helical | IPR011990 | - | 0.0 | - |
| Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
| Sma3 | IPR017442 | - | 0.0 | - | |
| Sma3 | Thioredoxin, conserved site | IPR017937 | - | 0.0 | - |
| Sma3 | Asp/Glu racemase, active site | IPR018187 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G15510.1 | ATECB2, ECB2, VAC1 Tetratricopeptide repeat (TPR)-like superfamily protein chr1:5329111-5331711 FORWARD LENGTH=866 | 3.0e-23 | 61% |
| RefSeq | Arabidopsis thaliana | NP_173004.1 | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] | 4.0e-23 | 61% |
| RefSeq | Populus trichocarpa | XP_002302824.1 | predicted protein [Populus trichocarpa] | 3.0e-26 | 66% |
| Full-Lengther Next Prediction |
|---|
Fln status: Putative C-terminus
Fln database: coniferopsida.fasta
Fln subject: D5AB53
Fln msg: STOP codon was not found. Distance to subject end: 8 aas, your sequence is shorter than subject: 70 - 232
Fln protein:
N
Protein Length:
71
Fln nts:
C
Fln Alignment:
HIF1XHV01A7AR2___NLMTQCYHITPRMEHYCCMVDLLGRAGMLVEAHDFINKMPIKPDAAVWGSMLGACRIHANVELGEMVAER
D5AB53________________NSMSVDYHITPVMEHYCCMVDLLGRTGCLDEAHDFINKMPIEPDTAVWQSLLGACRTHANVDLGEKVAER
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
