UniGene Name: sp_v3.0_unigene167370
Length: 239 nt
UniGene Fasta |
---|
>sp_v3.0_unigene167370
G |
Ace file of the UniGene sp_v3.0_unigene167370 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Unassigned protein | - | - | 0.0 | - |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 41% |
Sma3 | Retrotransposon protein, putative, Ty3-gypsy subclass | - | - | 6.289e-40 | - |
Source | Gene names |
---|---|
Sma3 | At2g14650; B1168G10.5; B1234D02.1; H0211F06-OSIGBa0153M17.10; H0306B06.3; H0306F03.2; H0409D10.7; H0425E08.11; H0502G05.12; H0512B01.1; H0522A01.6; H0613A10.2; H0616A11.2; H0616A11.3; H0616A11.5; H0622G10.3; H0807C06-H0308C08.3; H0807C06-H0308C08.6; H0820 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | chromatin | GO:0000785 | Cellular Component | 0.0 | - |
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | chromatin binding | GO:0003682 | Molecular Function | 0.0 | - |
Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
Sma3 | transporter activity | GO:0005215 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
Sma3 | chromatin assembly or disassembly | GO:0006333 | Biological Process | 0.0 | - |
Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
Sma3 | transport | GO:0006810 | Biological Process | 0.0 | - |
Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Reverse transcriptase | IPR000477 | - | 0.0 | - |
Sma3 | Chromo domain/shadow | IPR000953 | - | 0.0 | - |
Sma3 | Integrase, catalytic core | IPR001584 | - | 0.0 | - |
Sma3 | Zinc finger, CCHC-type | IPR001878 | - | 0.0 | - |
Sma3 | Peptidase aspartic, active site | IPR001969 | - | 0.0 | - |
Sma3 | Peptidase A2A, retrovirus, catalytic | IPR001995 | - | 0.0 | - |
Sma3 | Retrotransposon gag protein | IPR005162 | - | 0.0 | - |
Sma3 | General substrate transporter | IPR005828 | - | 0.0 | - |
Sma3 | Domain of unknown function DUF834 | IPR008552 | - | 0.0 | - |
Sma3 | Retroviral aspartyl protease | IPR013242 | - | 0.0 | - |
Sma3 | Zinc finger, H2C2-type, histone UAS binding | IPR015416 | - | 0.0 | - |
Full-Lengther Next Prediction |
---|
Fln status: Putative Complete
Fln database: coniferopsida.fasta
Fln subject: D5ABB2
Fln msg: atg_distance in limit (1-15): atg_distance = 15, W2: There is no M at the beginning,
Fln protein:
E
Protein Length:
68
Fln nts:
G
Fln Alignment:
HIF1XHV01AMTK0___DVLQHVKECDVCQRNKGEMSHLAGLLQPLPIPEGKWESISIDFITGLPMVQ-GKDCIFVVVD
D5ABB2________________DVSKYIRSCSACSIAKPAIKK-QGLYTPLPTLDRPWESISMDYMSGLPSTKHGNDYVFVVVD
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain