|
||||||
|
UniGene Name: sp_v3.0_unigene167348
Length: 244 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene167348
C |
|
Ace file of the UniGene sp_v3.0_unigene167348
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | putative protein kinase [Arabidopsis thaliana] | - | - | 2.0e-29 | 86% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 51% |
| Sma3 | Protein kinase domain containing protein, expressed | - | - | 3.601e-09 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Mitogen-activated protein kinase kinase kinase. | EC:2.7.11.25 | - | 3.445e-07 | - |
| Sma3 | EC:2.7.11.3- | - | 3.126e-09 | - |
| Source | Gene names |
|---|---|
| Sma3 | AT1G31420; AT1G60800; AT2G35620; AT3G24550; AT4g01330; AT4g02630; AT4g34500; AT5G62710; A_IG002N01.22; At1g01540; At1g26150; At1g49270; At1g56720; At1g60800; At1g68690; At1g70460; At2g20300; At2g35620; At2g42960; At3g17420; At3g58690/T20N10_40; At3g59110; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | integral to plasma membrane | GO:0005887 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | protein kinase activity | GO:0004672 | Molecular Function | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
| Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | protoderm histogenesis | GO:0010068 | Biological Process | 0.0 | - |
| Sma3 | cuticle development | GO:0042335 | Biological Process | 0.0 | - |
| Sma3 | shoot development | GO:0048367 | Biological Process | 0.0 | - |
| Sma3 | organ formation | GO:0048645 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
| Sma3 | Chromo domain/shadow | IPR000953 | - | 0.0 | - |
| Sma3 | Bromo adjacent homology (BAH) domain | IPR001025 | - | 0.0 | - |
| Sma3 | Serine-threonine/tyrosine-protein kinase catalytic domain | IPR001245 | - | 0.0 | - |
| Sma3 | Aminoacyl-tRNA synthetase, class I, conserved site | IPR001412 | - | 0.0 | - |
| Sma3 | C-5 cytosine methyltransferase | IPR001525 | - | 0.0 | - |
| Sma3 | Leucine-rich repeat | IPR001611 | - | 0.0 | - |
| Sma3 | Gnk2-homologous domain | IPR002902 | - | 0.0 | - |
| Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
| Sma3 | EGF-like region, conserved site | IPR013032 | - | 0.0 | - |
| Sma3 | Leucine-rich repeat-containing N-terminal, type 2 | IPR013210 | - | 0.0 | - |
| Sma3 | SKG6/AXL2 alpha-helix transmembrane domain | IPR014805 | - | 0.0 | - |
| Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
| Sma3 | IPR017442 | - | 0.0 | - | |
| Sma3 | ABC transporter, conserved site | IPR017871 | - | 0.0 | - |
| Sma3 | DNA methylase, C-5 cytosine-specific, active site | IPR018117 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G56720.1 | Protein kinase superfamily protein chr1:21263630-21265559 REVERSE LENGTH=492 | 3.0e-37 | 86% |
| RefSeq | Arabidopsis thaliana | NP_564722.1 | protein kinase [Arabidopsis thaliana] | 4.0e-37 | 86% |
| RefSeq | Populus trichocarpa | XP_002330049.1 | predicted protein [Populus trichocarpa] | 8.0e-37 | 86% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5ACH5
Fln msg: Distance to subject end: 146 aas, your sequence is shorter than subject: 81 - 246
Fln protein:
F
Protein Length:
82
Fln nts:
C
Fln Alignment:
HIF1XHV01B5QPY___LTWEARMKIIFGTAKALAYLHEALEPKVVHRDIKSSNILIHHEFNAKVSDFGLAKLL-GSGKSHVTTRVMGSSRSFIP
D5ACH5________________LSWPQRRKIVMGTAKGLAYLHDGIQPAIYHRDIKPTNILLDDEMNAFVADFGLARMMTKGGESHITTKVAGTHGYLAP
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
