UniGene Name: sp_v3.0_unigene167322
Length: 226 nt
UniGene Fasta |
---|
>sp_v3.0_unigene167322
C |
Ace file of the UniGene sp_v3.0_unigene167322 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | [RTKL] COG0515 Serine/threonine protein kinase | - | - | 6.0e-08 | 46% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 56% |
Sma3 | Receptor serine-threonine protein kinase, putative | - | - | 4.672e-19 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Non-specific protein-tyrosine kinase. | EC:2.7.10.2 | - | 1.328e-12 | - |
Sma3 | [G-protein-coupled receptor] kinase. | EC:2.7.11.16 | - | 6.913e-06 | - |
Source | Gene names |
---|---|
Sma3 | APK2b; ARSK1; AT1G06700; AT1G53730; AT3G14350; AT3G59350; AT4G22130; At1g06700; At1g20650; At1g53730; At1g68690; At1g76370; At2g02800; At2g02800/T20F6.6; At2g26290; At2g28590; At2g30740; At3g07070; At3g14350; At3g59350; At3g59350/F25L23_210; At4g22130; At |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | protein kinase activity | GO:0004672 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | IQ motif, EF-hand binding site | IPR000048 | - | 0.0 | - |
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | Serine-threonine/tyrosine-protein kinase catalytic domain | IPR001245 | - | 0.0 | - |
Sma3 | Myosin head, motor domain | IPR001609 | - | 0.0 | - |
Sma3 | Leucine-rich repeat | IPR001611 | - | 0.0 | - |
Sma3 | Dilute | IPR002710 | - | 0.0 | - |
Sma3 | Myosin, N-terminal, SH3-like | IPR004009 | - | 0.0 | - |
Sma3 | Phosphopantetheine attachment site | IPR006162 | - | 0.0 | - |
Sma3 | Tyrosine-protein kinase, active site | IPR008266 | - | 0.0 | - |
Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
Sma3 | Leucine-rich repeat-containing N-terminal, type 2 | IPR013210 | - | 0.0 | - |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Sma3 | IPR017442 | - | 0.0 | - | |
Sma3 | Homeobox, conserved site | IPR017970 | - | 0.0 | - |
Sma3 | Dil domain | IPR018444 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G22130.1 | SRF8 STRUBBELIG-receptor family 8 chr4:11723733-11727331 FORWARD LENGTH=703 | 3.0e-34 | 82% |
RefSeq | Arabidopsis thaliana | NP_001119030.1 | STRUBBELIG-receptor family 8 protein [Arabidopsis thaliana] | 2.0e-34 | 82% |
RefSeq | Populus trichocarpa | XP_002316561.1 | predicted protein [Populus trichocarpa] | 2.0e-36 | 83% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5AAA3
Fln msg: Distance to subject end: 147 aas, your sequence is shorter than subject: 74 - 458
Fln protein:
R
Protein Length:
75
Fln nts:
C
Fln Alignment:
HIF1XHV01A3CKZ___RLSDCGIAALNPNSER-QVQVQVLGSFGYSAPEYVMSGIYTMKSDVYSFGVVMLELLTGRKPLDSSRTRSEQSLV
D5AAA3________________KLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPEYAMTGQLTIKSDVYSFGVVLLELITGRKAIDNSRSAGENNLV
SSRs (tot: 1) |
---|
Start position | End position | Sequence | Length |
---|---|---|---|
50 | 67 | TCAGGT TCAGGT TCAGGT | 18 |
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain