|
||||||
|
UniGene Name: sp_v3.0_unigene167218
Length: 188 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
 UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene167218
A |
|
Ace file of the UniGene sp_v3.0_unigene167218 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] sp|Q9SHZ8.1|PP168_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At2g22070 gb|AAD25817.1| hypothetical protein [Arabidopsis thaliana] gb|AEC07259.1| pentatricopeptide repe | - | - | 2.0e-21 | 84% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 78% |
| Sma3 | Putative pentatricopeptide (PPR) repeat-containing protein | - | - | 1.31e-06 | - |
| Source | Gene names |
|---|---|
| Sma3 | At1g04840; At1g09410; At1g18485; At1g20230; At1g47580; At1g56690; At2g15690; At2g22070; At3g12770; At3g23330; At3g24000; At3g26782; At3g49170; At3g62890; At4g14850; At4g16835; At4g30700; At4g32450; At4g33170; At4g33990; At5g06540; At5g09950; B1032F05.19; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
| Sma3 | ribosome | GO:0005840 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | nucleotide binding | GO:0000166 | Molecular Function | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
| Sma3 | structural constituent of ribosome | GO:0003735 | Molecular Function | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | methyltransferase activity | GO:0008168 | Molecular Function | 0.0 | - |
| Sma3 | DNA methylation | GO:0006306 | Biological Process | 0.0 | - |
| Sma3 | translation | GO:0006412 | Biological Process | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
| Sma3 | embryo development ending in seed dormancy | GO:0009793 | Biological Process | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT2G22070.1 | pentatricopeptide (PPR) repeat-containing protein chr2:9383602-9385962 FORWARD LENGTH=786 | 2.0e-27 | 84% |
| RefSeq | Arabidopsis thaliana | NP_179798.1 | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] | 3.0e-27 | 84% |
| RefSeq | Populus trichocarpa | XP_002310592.1 | predicted protein [Populus trichocarpa] | 1.0e-24 | 78% |
| Full-Lengther Next Prediction |
|---|
Fln status: C-terminus
Fln database: coniferopsida.fasta
Fln subject: A9P0W0
Fln msg: your sequence is shorter than subject: 53 - 370
Fln protein:
T
Protein Length:
54
Fln nts:
A
Fln Alignment:
HIF1XHV01BBBEM___TTIRVIKNLRVCGDCHTAIKFISKLVAREMIVRDTNRFHHFKDGWCSCRDYW
A9P0W0________________TTIRVVKNLRVCGDCHTATKFISRIVSREIVLRDTHRFHHFKDGQCSCGDYW
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
