UniGene Name: sp_v3.0_unigene167126
Length: 187 nt
UniGene Fasta |
---|
>sp_v3.0_unigene167126
G |
Ace file of the UniGene sp_v3.0_unigene167126 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | beta-hexosaminidase 3 [Arabidopsis thaliana] gb|AAM91092.1| At1g65600/F5I14_13 [Arabidopsis thaliana] gb|AAN33206.1| At1g65600/F5I14_13 [Arabidopsis thaliana] gb|AEE34399.1| beta-hexosaminidase 3 [Arabidopsis thaliana] | - | - | 2.0e-23 | 83% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 65% |
Sma3 | Putative beta-N-acetylhexosaminidase | - | - | 3.456e-12 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Beta-N-acetylhexosaminidase. | EC:3.2.1.52 | - | 6.911e-12 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Other glycan degradation | 00511 | 6.911e-12 | % | |
Sma3 | Various types of N-glycan biosynthesis | 00513 | 6.911e-12 | % | |
Sma3 | Amino sugar and nucleotide sugar metabolism | 00520 | 6.911e-12 | % | |
Sma3 | Glycosaminoglycan degradation | 00531 | 6.911e-12 | % | |
Sma3 | Glycosphingolipid biosynthesis - globo series | 00603 | 6.911e-12 | % | |
Sma3 | Glycosphingolipid biosynthesis - ganglio series | 00604 | 6.911e-12 | % | |
Sma3 | Metabolic pathways | 01100 | 6.911e-12 | % |
Source | Gene names |
---|---|
Sma3 | At1g65590; At3g55260; B1078G07.2; F5I14.13; GSVIVT00009334001; OJ1123_C08.10; OJ1654_B10.16; OSJNBa0084P24.2; Os01g0891000; Os05g0115900; Os05g0415700; OsI_18203; OsI_19972; OsJ_04367; OsJ_16891; OsJ_18555; P0496H07.6; PHYPADRAFT_128384; POPTRDRAFT_109222 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | plant-type cell wall | GO:0009505 | Cellular Component | 0.0 | - |
Sma3 | beta-N-acetylhexosaminidase activity | GO:0004563 | Molecular Function | 0.0 | - |
Sma3 | cation binding | GO:0043169 | Molecular Function | 0.0 | - |
Sma3 | carbohydrate metabolic process | GO:0005975 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Glycoside hydrolase, family 20 | IPR001540 | - | 0.0 | - |
Sma3 | TonB box, conserved site | IPR010916 | - | 0.0 | - |
Sma3 | Glycoside hydrolase, subgroup, catalytic domain | IPR013781 | - | 0.0 | - |
Sma3 | Acetylhexosaminidase, subunit a/b | IPR015882 | - | 0.0 | - |
Sma3 | Glycoside hydrolase, family 20, catalytic core | IPR015883 | - | 0.0 | - |
Sma3 | IPR017909 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G65590.1 | HEXO3, ATHEX1 beta-hexosaminidase 3 chr1:24385996-24390989 FORWARD LENGTH=535 | 4.0e-30 | 83% |
RefSeq | Arabidopsis thaliana | NP_176737.2 | beta-hexosaminidase 3 [Arabidopsis thaliana] | 5.0e-30 | 83% |
RefSeq | Populus trichocarpa | XP_002311272.1 | predicted protein [Populus trichocarpa] | 7.0e-32 | 86% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LLF7
Fln msg: Distance to subject end: 17 aas, your sequence is shorter than subject: 61 - 554
Fln protein:
M
Protein Length:
62
Fln nts:
G
Fln Alignment:
HLKU4M003GKXRJ___MWGETVDASDIEQTIWPRAAAAAERLWTPYDKIAKDPNEVVYRLANFRCLLNQRGVSAAPL
B8LLF7________________MWGETADASDIQQTIWPRAAAAAERLWSTEDDTSNGLSTALPRLRNFRCVLNQRGIAAAPV
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain