UniGene Name: sp_v3.0_unigene166903
Length: 199 nt
UniGene Fasta |
---|
>sp_v3.0_unigene166903
A |
Ace file of the UniGene sp_v3.0_unigene166903 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | 26S proteasome regulatory subunit N1 [Arabidopsis thaliana] sp|Q9SIV2.2|RPN1A_ARATH RecName: Full=26S proteasome non-ATPase regulatory subunit 2 1A; AltName: Full=26S proteasome regulatory subunit RPN1 A; Short=AtRPN1a; AltName: Full=26S proteasome regula | - | - | 1.0e-19 | 65% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 89% |
Sma3 | Putative 26S proteasome regulatory subunit S2 | - | - | 1.243e-12 | - |
Source | Gene names |
---|---|
Sma3 | AT4g28470; At2g20580; At4g28470; CHLREDRAFT_137945; F20O9.150; GSVIVT00018640001; OJ1008_C03.11; Os02g0146700; Os09g0326800; OsI_05066; OsI_05840; OsI_24349; OsI_30901; OsJ_05368; OsJ_22525; OsJ_28885; Ot09g01110; P0468G03.16; P0692F07.34; P0706E03.1; PHY |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | proteasome complex | GO:0000502 | Cellular Component | 0.0 | - |
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | cytosol | GO:0005829 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | proteasome regulatory particle, base subcomplex | GO:0008540 | Cellular Component | 0.0 | - |
Sma3 | protein complex | GO:0043234 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | DNA-dependent ATPase activity | GO:0008094 | Molecular Function | 0.0 | - |
Sma3 | enzyme regulator activity | GO:0030234 | Molecular Function | 0.0 | - |
Sma3 | DNA metabolic process | GO:0006259 | Biological Process | 0.0 | - |
Sma3 | regulation of protein catabolic process | GO:0042176 | Biological Process | 0.0 | - |
Sma3 | regulation of cell cycle | GO:0051726 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | IPR001553 | - | 0.0 | - | |
Sma3 | Proteasome/cyclosome, regulatory subunit | IPR002015 | - | 0.0 | - |
Sma3 | Armadillo-like helical | IPR011989 | - | 0.0 | - |
Sma3 | 26S proteasome regulatory complex, non-ATPase subcomplex, Rpn1 subunit | IPR016643 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT2G20580.1 | RPN1A, ATRPN1A 26S proteasome regulatory subunit S2 1A chr2:8859211-8864699 FORWARD LENGTH=891 | 5.0e-25 | 65% |
RefSeq | Arabidopsis thaliana | NP_565477.1 | 26S proteasome regulatory subunit N1 [Arabidopsis thaliana] | 6.0e-25 | 65% |
RefSeq | Populus trichocarpa | XP_002310411.1 | predicted protein [Populus trichocarpa] | 2.0e-25 | 69% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LRR7
Fln msg: Distance to subject end: 398 aas, your sequence is shorter than subject: 66 - 892
Fln protein:
T
Protein Length:
67
Fln nts:
A
Fln Alignment:
HLKU4M003F02VJ___TQIDKYFSSNDNHVMVGALLAVGIINCGIQNECDPAYALLAECISKDESNIRIGAIMGPGLAYAGS
B8LRR7________________TQIDKYFSSNDNHAIAGALLAVGIVNCGIQNECDPAYALLAEYVSKDESNIRIGAIMGLGLAYAGS
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain