SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene166718

Length: 205 nt

UniGene Fasta

>sp_v3.0_unigene166718
ATTTGAACGCACAAAGAGCAGCAGTATGGGAGAGAGTTCAAGTAGCAGACAACTGAGATGGTCACTGCAAGGCATGACAGCCCTAGTCACTGGGGGTACCAAAGGAATTGGACGTGCTATTGTAGAAGAACTAGCAGGTTTTGGAGCTGCTGTTTATACATGTTGCCGTACAGAAAAGGATCTTAATGACTGTTTGACTCAATGG

Ace file of the UniGene sp_v3.0_unigene166718

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Chain A, Tropinone Reductase-Ii Complexed With Nadph pdb\|1IPE\|B Chain B, Tropinone Reductase-Ii Complexed With Nadph pdb\|1IPF\|A Chain A, Tropinone Reductase-Ii Complexed With Nadph And Tropinone pdb\|1IPF\|B Chain B, Tropinone Reductase-Ii Complexed With Na	-	-	2.0e-12	73%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	93%
Sma3	Putative tropinone reductase	-	-	3.60204e-41	-

Source	ECs	Term	Type	e value	Identity
Sma3	Tropinone reductase I.	EC:1.1.1.206	-	4.546e-25	-

Source	KEGGs	Term	Type	e value	Identity
Sma3	Tropane, piperidine and pyridine alkaloid biosynthesis	00960		4.546e-25	%
Sma3	Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid	01064		4.546e-25	%
Sma3	Metabolic pathways	01100		4.546e-25	%
Sma3	Biosynthesis of secondary metabolites	01110		4.546e-25	%
Sma3	Tropinone reductase II.	EC:1.1.1.236	-	3.188e-07	-

Source	KEGGs	Term	Type	e value	Identity
Sma3	Tropane, piperidine and pyridine alkaloid biosynthesis	00960		3.188e-07	%

Source	Gene names
Sma3	At1g07440; At1g07450; At2g29150; At2g29260; At2g29290; At2g29300; At2g29310; At2g29320; At2g29330; At2g29340; At2g29360; At2g30670; At5g06060; DcADH; F22G5.20; F22G5.39; F22G5_16; GSVIVT00018424001; GSVIVT00018426001; GSVIVT00018429001; GSVIVT00018430001;

Source	GOs	Term	Type	Identity
Sma3	intracellular	GO:0005622	Cellular Component	-
Sma3	DNA binding	GO:0003677	Molecular Function	-
Sma3	binding	GO:0005488	Molecular Function	-
Sma3	zinc ion binding	GO:0008270	Molecular Function	-
Sma3	oxidoreductase activity	GO:0016491	Molecular Function	-
Sma3	tropine dehydrogenase activity	GO:0050356	Molecular Function	-
Sma3	tropinone reductase activity	GO:0050358	Molecular Function	-
Sma3	metabolic process	GO:0008152	Biological Process	-
Sma3	DNA integration	GO:0015074	Biological Process	-
Sma3	oxidation-reduction process	GO:0055114	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Integrase, catalytic core	IPR001584	-	-
Sma3	Zinc finger, CCHC-type	IPR001878	-	-
Sma3	Short-chain dehydrogenase/reductase SDR	IPR002198	-	-
Sma3	Glucose/ribitol dehydrogenase	IPR002347	-	-
Sma3	Sugar transporter, conserved site	IPR005829	-	-
Sma3	Acyl-CoA dehydrogenase, conserved site	IPR006089	-	-
Sma3	Zinc finger, C2H2	IPR007087	-	-
Sma3	Reverse transcriptase, RNA-dependent DNA polymerase	IPR013103	-	-
Sma3	Zinc finger, C2H2-like	IPR015880	-	-
Sma3	NAD(P)-binding domain	IPR016040	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT2G29260.1	NAD(P)-binding Rossmann-fold superfamily protein chr2:12582523-12583954 FORWARD LENGTH=322	2.0e-16	71%
RefSeq	Arabidopsis thaliana	NP_180489.1	tropine dehydrogenase [Arabidopsis thaliana]	3.0e-16	71%
RefSeq	Populus trichocarpa	XP_002311182.1	predicted protein [Populus trichocarpa]	2.0e-17	73%

Full-Lengther Next Prediction

Fln status: N-terminus

Fln database: coniferopsida.fasta

Fln subject: D5ABQ5

Fln msg: Distance to subject end: 206 aas, your sequence is shorter than subject: 60 - 266

Fln protein: MGESSSSRQLRWSLQGMTALVTGGTKGIGRAIVEELAGFGAAVYTCCRTEKDLNDCLTQW

Protein Length: 61

Fln nts: ATTTGAACGCACAAAGAGCAGCAGT_-_ATGGGAGAGAGTTCAAGTAGCAGACAACTGAGATGGTCACTGCAAGGCATGACAGCCCTAGTCACTGGGGGTACCAAAGGAATTGGACGTGCTATTGTAGAAGAACTAGCAGGTTTTGGAGCTGCTGTTTATACATGTTGCCGTACAGAAAAGGATCTTAATGACTGTTTGACTCAATGG

Fln Alignment:

HLKU4M003G0SY0___GMTALVTGGTKGIGRAIVEELAGFGAAVYTCCRTEKDLNDCLTQW
D5ABQ5________________GMTALVTGGTKGIGRAVVEELAGFGAAVYTCGRTEKDLNDCLNQW

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain