UniGene Name: sp_v3.0_unigene165602
Length: 176 nt
![]() |
---|
>sp_v3.0_unigene165602
G |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | DNA mismatch repair protein PMS2 [Arabidopsis thaliana] gb|AAL01156.1| DNA mismatch repair protein [Arabidopsis thaliana] gb|AEE82175.1| DNA mismatch repair protein PMS2 [Arabidopsis thaliana] | - | - | 3.0e-18 | 80% |
FL-Next | tr=Predicted protein; subsp. trichocarpa). | - | - | 0.0 | 81% |
Source | Gene names |
---|---|
Sma3 | AT4g02460; At4g02460; At4g02460/T14P8_6; GSVIVT00027977001; MICPUCDRAFT_4434; MICPUN_65816; OSJNBa0016G10.12; OSTLU_432; Os02g0592300; OsI_07875; OsJ_07338; PHYPADRAFT_155569; PMS1; POPTRDRAFT_572706; Pms1; RCOM_1177300; T14P8.6; VITISV_023640; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
Sma3 | thiamine diphosphokinase activity | GO:0004788 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | nucleoside-triphosphatase activity | GO:0017111 | Molecular Function | 0.0 | - |
Sma3 | mismatched DNA binding | GO:0030983 | Molecular Function | 0.0 | - |
Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
Sma3 | mismatch repair | GO:0006298 | Biological Process | 0.0 | - |
Sma3 | thiamine metabolic process | GO:0006772 | Biological Process | 0.0 | - |
Sma3 | thiamine diphosphate biosynthetic process | GO:0009229 | Biological Process | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G02460.1 | PMS1 DNA mismatch repair protein, putative chr4:1076306-1080510 REVERSE LENGTH=923 | 2.0e-23 | 80% |
RefSeq | Arabidopsis thaliana | NP_567236.1 | DNA mismatch repair protein PMS2 [Arabidopsis thaliana] | 2.0e-23 | 80% |
RefSeq | Populus trichocarpa | XP_002321013.1 | predicted protein [Populus trichocarpa] | 9.0e-25 | 81% |
![]() |
---|
Fln status: Putative N-terminus
Fln database: tr_plants
Fln subject: B9I9S8
Fln msg: Distance to subject end: 843 aas, atg_distance in limit (1-15): atg_distance = 14, W2: There is no M at the beginning, your sequence is shorter than subject: 58 - 915
Fln protein:
A
Protein Length:
59
Fln nts:
G
Fln Alignment:
HLKU4M003HC3MJ___ADVHRICSGQVILDLSSAVKELVENSLDAGASSIEVKLKEYGGESFEVGDNGCGISPD
B9I9S8________________AAVHRICAGQVILDLSSAVKELVENSLDAGATSIEISLKDYGLESFQVIDNGCGVSPN
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain