|
||||||
|
UniGene Name: sp_v3.0_unigene165243
Length: 136 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene165243
A |
|
Ace file of the UniGene sp_v3.0_unigene165243
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Cellulose synthase-like D4 n=1 Tax=Physcomitrella patens RepID=Q09HT7_9BRYO | - | - | 6.0e-14 | 75% |
| FL-Next | sp=Cellulose synthase-like protein D3; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 72% |
| Sma3 | Cellulose synthase-like protein D4 | - | - | 9.521e-08 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Transferases, Glycosyltransferases, Hexosyltransferases. | EC:2.4.1.- | - | 1.796e-11 | - |
| Source | Gene names |
|---|---|
| Sma3 | At3g03050; At4g38190; At5g16910; CSLD2; CSLD3; CSLD4; F20D10.310; F2K13.60; GSVIVT00014029001; GSVIVT00015671001; GSVIVT00036303001; KJK; LOC_Os08g25710; Os08g0345500; OsI_027835; OsJ_025895; P0410E11.117; PHYPADRAFT_150074; PHYPADRAFT_211198; PHYPADRAFT_ |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Golgi membrane | GO:0000139 | Cellular Component | 0.0 | - |
| Sma3 | endoplasmic reticulum | GO:0005783 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | integral to Golgi membrane | GO:0030173 | Cellular Component | 0.0 | - |
| Sma3 | cellulose synthase (UDP-forming) activity | GO:0016760 | Molecular Function | 0.0 | - |
| Sma3 | cellular cell wall organization | GO:0007047 | Biological Process | 0.0 | - |
| Sma3 | response to cold | GO:0009409 | Biological Process | 0.0 | - |
| Sma3 | pollen germination | GO:0009846 | Biological Process | 0.0 | - |
| Sma3 | cellulose biosynthetic process | GO:0030244 | Biological Process | 0.0 | - |
| Sma3 | root hair elongation | GO:0048767 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Cellulose synthase | IPR005150 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G03050.1 | CSLD3, KJK, ATCSLD3 cellulose synthase-like D3 chr3:687873-691629 FORWARD LENGTH=1145 | 2.0e-17 | 72% |
| RefSeq | Arabidopsis thaliana | NP_186955.1 | cellulose synthase-like protein D3 [Arabidopsis thaliana] | 3.0e-17 | 72% |
| RefSeq | Populus trichocarpa | XP_002328950.1 | glycosyltransferase, CAZy family GT2 [Populus trichocarpa] | 7.0e-18 | 75% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q9M9M4
Fln msg: Distance to subject end: 980 aas, your sequence is shorter than subject: 44 - 1145
Fln protein:
M
Protein Length:
45
Fln nts:
A
Fln Alignment:
HA8LWWM01DRP7X___MAGARGLSSCAVDGCDGKVMRDERGEDILPCDCNYKICRDCYFD
Q9M9M4________________MAGAKG-SSCAVPGCDVKVMSDERGQDLLPCECDFKICRDCFMD
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
