UniGene Name: sp_v3.0_unigene164322
Length: 165 nt
UniGene Fasta |
---|
>sp_v3.0_unigene164322
A |
Ace file of the UniGene sp_v3.0_unigene164322 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | putative thiamin pyrophosphokinase [Oryza sativa Japonica Group] dbj|BAD53067.1| putative thiamin pyrophosphokinase [Oryza sativa Japonica Group] | - | - | 9.0e-13 | 62% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 96% |
Sma3 | Thiamin pyrophosphokinase 1 | - | - | 1.592e-08 | - |
Source | Gene names |
---|---|
Sma3 | B1157F09.24; GSVIVT00027976001; OSJNBa0052O12.42-1; OSJNBa0090H02.18; Os01g0356500; Os01g0931400; Os05g0367400; OsI_05056; OsJ_01724; OsJ_04650; OsJ_18271; P0025H06.10; P0506E04.20-1; POPTRDRAFT_572707; POPTRDRAFT_816675; RCOM_1177290; VITISV_023640; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
Sma3 | thiamine diphosphokinase activity | GO:0004788 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | kinase activity | GO:0016301 | Molecular Function | 0.0 | - |
Sma3 | nucleoside-triphosphatase activity | GO:0017111 | Molecular Function | 0.0 | - |
Sma3 | mismatched DNA binding | GO:0030983 | Molecular Function | 0.0 | - |
Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
Sma3 | mismatch repair | GO:0006298 | Biological Process | 0.0 | - |
Sma3 | thiamine metabolic process | GO:0006772 | Biological Process | 0.0 | - |
Sma3 | thiamine diphosphate biosynthetic process | GO:0009229 | Biological Process | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G02880.3 | TPK1 thiamin pyrophosphokinase1 chr1:643063-644485 REVERSE LENGTH=267 | 9.0e-14 | 56% |
RefSeq | Arabidopsis thaliana | NP_001117219.1 | thiamin pyrophosphokinase1 [Arabidopsis thaliana] | 6.0e-14 | 56% |
RefSeq | Populus trichocarpa | XP_002320349.1 | predicted protein [Populus trichocarpa] | 6.0e-21 | 64% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LN96
Fln msg: Distance to subject end: 123 aas, your sequence is shorter than subject: 54 - 230
Fln protein:
L
Protein Length:
55
Fln nts:
A
Fln Alignment:
HA8LWWM01B2EXE___LDSIRPEVREFYDNLGSTILDESYDQDTTDLHKCIAFIRDCTPDLEKSNLILLV
B8LN96________________LDSIRPEVREFYDNLGSTVLDESYDQDTTDLHKCIAFIRDCTPDLEKSNLILLI
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain