UniGene Name: sp_v3.0_unigene164200
Length: 224 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
![]() |
---|
>sp_v3.0_unigene164200
T |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Reverse transcriptase (Fragment) n=3 Tax=Eleocharis cellulosa RepID=D5LVM7_9POAL | - | - | 3.0e-15 | 58% |
FL-Next | tr=Uncharacterized protein; Glycine max (Soybean) (Glycine hispida). | - | - | 0.0 | 61% |
Sma3 | Retrotransposon protein, putative, unclassified | - | - | 2.048e-10 | - |
Source | Gene names |
---|---|
Sma3 | LOC_Os03g05350; LOC_Os03g06110; LOC_Os03g61190; LOC_Os10g13960; LOC_Os10g16880; LOC_Os10g28310; LOC_Os10g37610; LOC_Os11g06400; LOC_Os11g08610; LOC_Os12g24050; MtrDRAFT_AC150244g37v2; OJ1004_F02.14; OJ1111_B11.1; OSIGBa0114M03.4; OSJNBa0004L19.22; OSJNBa0 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | chromatin | GO:0000785 | Cellular Component | 0.0 | - |
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | chromatin binding | GO:0003682 | Molecular Function | 0.0 | - |
Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
Sma3 | triglyceride lipase activity | GO:0004806 | Molecular Function | 0.0 | - |
Sma3 | transporter activity | GO:0005215 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
Sma3 | chromatin assembly or disassembly | GO:0006333 | Biological Process | 0.0 | - |
Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
Sma3 | lipid metabolic process | GO:0006629 | Biological Process | 0.0 | - |
Sma3 | transport | GO:0006810 | Biological Process | 0.0 | - |
Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Reverse transcriptase | IPR000477 | - | 0.0 | - |
Sma3 | Chromo domain/shadow | IPR000953 | - | 0.0 | - |
Sma3 | Integrase, catalytic core | IPR001584 | - | 0.0 | - |
Sma3 | Zinc finger, CCHC-type | IPR001878 | - | 0.0 | - |
Sma3 | Peptidase aspartic, active site | IPR001969 | - | 0.0 | - |
Sma3 | Lipase, class 3 | IPR002921 | - | 0.0 | - |
Sma3 | Retrotransposon gag protein | IPR005162 | - | 0.0 | - |
Sma3 | General substrate transporter | IPR005828 | - | 0.0 | - |
Sma3 | Peptidase aspartic, catalytic | IPR009007 | - | 0.0 | - |
Sma3 | Retroviral aspartyl protease | IPR013242 | - | 0.0 | - |
Sma3 | Zinc finger, H2C2-type, histone UAS binding | IPR015416 | - | 0.0 | - |
Sma3 | MULE transposase domain | IPR018289 | - | 0.0 | - |
![]() |
---|
Fln status: Internal
Fln database: tr_plants
Fln subject: I1KED9
Fln msg: Distance to subject end: 740 aas, your sequence is shorter than subject: 74 - 1534
Fln protein:
D
Protein Length:
75
Fln nts:
T
Fln Alignment:
HA8LWWM01BLEQD___DELLDELQGPIYFTKLDLHSGYHQIRMKTEDILKTTFRTHEVIMNFWSCLLALL---IHIQDLMNSIFKPFLRKFVL
I1KED9________________DELLDELHGSAYFSKLDLKSGYHQIRMKEEDIHKTAFRTHEGHYEFMVMPFGLTNAPATFQSVMNEIFKPYLRRFVL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain