|
||||||
|
UniGene Name: sp_v3.0_unigene163809
Length: 242 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene163809
A |
|
Ace file of the UniGene sp_v3.0_unigene163809
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Pentatricopeptide repeat protein (Fragment) n=1 Tax=Cycas revoluta RepID=B3U1U9_CYCRE | - | - | 3.0e-25 | 70% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 67% |
| Sma3 | Pentatricopeptide repeat protein | - | - | 0.0 | - |
| Source | Gene names |
|---|---|
| Sma3 | At1g11290; At2g01510; At3g08820; At3g26782; At3g49140; At3g57430; At4g30700; B1032F05.19; DYW9; F17O14.29; F2I9.13; F2K15.2; GSVIVT00000293001; GSVIVT00001706001; GSVIVT00002068001; GSVIVT00003060001; GSVIVT00003383001; GSVIVT00004068001; GSVIVT0000646700 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | endonuclease activity | GO:0004519 | Molecular Function | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | mRNA modification | GO:0016556 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Peptidase S8/S53, subtilisin/kexin/sedolisin | IPR000209 | - | 0.0 | - |
| Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
| Sma3 | Legume lectin domain | IPR001220 | - | 0.0 | - |
| Sma3 | Pentatricopeptide repeat | IPR002885 | - | 0.0 | - |
| Sma3 | Uncharacterised protein family Cys-rich | IPR006461 | - | 0.0 | - |
| Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
| Sma3 | Tetratricopeptide-like helical | IPR011990 | - | 0.0 | - |
| Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
| Sma3 | IPR017442 | - | 0.0 | - | |
| Sma3 | Asp/Glu racemase, active site | IPR018187 | - | 0.0 | - |
| Sma3 | EF-Hand 1, calcium-binding site | IPR018247 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G49142.1 | Tetratricopeptide repeat (TPR)-like superfamily protein chr3:18215788-18217848 REVERSE LENGTH=686 | 1.0e-26 | 64% |
| RefSeq | Arabidopsis thaliana | NP_001190038.1 | tetratricopeptide repeat-like family protein [Arabidopsis thaliana] | 1.0e-26 | 64% |
| RefSeq | Populus trichocarpa | XP_002321443.1 | predicted protein [Populus trichocarpa] | 2.0e-25 | 60% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5ADG9
Fln msg: Distance to subject end: 53 aas, your sequence is shorter than subject: 80 - 312
Fln protein:
C
Protein Length:
81
Fln nts:
A
Fln Alignment:
HA8LWWM01EN4VR___CSLIEFNKKVYTFVVGDKSHPQSDKIYALLDTLAGKMKEAGYVPDTNFALHDVEEEVKEHNLSSHSEKLAIAFGLINTSS
D5ADG9________________CSLIEVNNKLHSFVVGDISHPQTEAIYAMLETLARQMEAVGYVPCTDFVLHDVEEEIKENMLFAHSEKLAIAFGLISTRS
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
