|
||||||
|
UniGene Name: sp_v3.0_unigene163723
Length: 239 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene163723
T |
|
Ace file of the UniGene sp_v3.0_unigene163723
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | MRP-like ABC transporter n=4 Tax=Oryza sativa RepID=Q8GU64_ORYSJ | - | - | 1.0e-27 | 83% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 49% |
| Sma3 | Multidrug resistance protein ABC transporter family | - | - | 4.209e-14 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Xenobiotic-transporting ATPase. | EC:3.6.3.44 | - | 1.738e-07 | - |
| Source | Gene names |
|---|---|
| Sma3 | At1g04120; At2g47800; At3g62700; B1157F09.14; EST3; F17A22.19; F20D22.11; F26K9.130; GSVIVT00027983001; GSVIVT00028471001; GSVIVT00028494001; LOC_Os03g04920; MRP10; MRP14; MRP4; MRP5; OSJNBa0035O13.14; OSJNBb0022P19.1; Os01g0356000; Os03g0142800; Os04g020 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | plant-type vacuole | GO:0000325 | Cellular Component | 0.0 | - |
| Sma3 | vacuolar membrane | GO:0005774 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | sulfonylurea receptor activity | GO:0008281 | Molecular Function | 0.0 | - |
| Sma3 | folic acid transporter activity | GO:0008517 | Molecular Function | 0.0 | - |
| Sma3 | xenobiotic-transporting ATPase activity | GO:0008559 | Molecular Function | 0.0 | - |
| Sma3 | ATPase activity | GO:0016887 | Molecular Function | 0.0 | - |
| Sma3 | ATPase activity, coupled to transmembrane movement of substances | GO:0042626 | Molecular Function | 0.0 | - |
| Sma3 | transport | GO:0006810 | Biological Process | 0.0 | - |
| Sma3 | response to water deprivation | GO:0009414 | Biological Process | 0.0 | - |
| Sma3 | response to wounding | GO:0009611 | Biological Process | 0.0 | - |
| Sma3 | response to nematode | GO:0009624 | Biological Process | 0.0 | - |
| Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
| Sma3 | stomatal movement | GO:0010118 | Biological Process | 0.0 | - |
| Sma3 | cellular potassium ion homeostasis | GO:0030007 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Histidine phosphatase superfamily, clade-2 | IPR000560 | - | 0.0 | - |
| Sma3 | ABC transporter, transmembrane domain | IPR001140 | - | 0.0 | - |
| Sma3 | ABC transporter-like | IPR003439 | - | 0.0 | - |
| Sma3 | AAA+ ATPase domain | IPR003593 | - | 0.0 | - |
| Sma3 | ABC transporter, conserved site | IPR017871 | - | 0.0 | - |
| Sma3 | ABC transporter, integral membrane type 1 | IPR017940 | - | 0.0 | - |
| Sma3 | Peroxidase, active site | IPR019794 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT2G47800.1 | ATMRP4, EST3, MRP4, ABCC4 multidrug resistance-associated protein 4 chr2:19574944-19580383 FORWARD LENGTH=1516 | 1.0e-29 | 78% |
| RefSeq | Arabidopsis thaliana | NP_182301.1 | ABC transporter C family member 4 [Arabidopsis thaliana] | 2.0e-29 | 78% |
| RefSeq | Populus trichocarpa | XP_002301476.1 | multidrug resistance protein ABC transporter family [Populus trichocarpa] | 2.0e-32 | 84% |
| Full-Lengther Next Prediction |
|---|
Fln status: C-terminus
Fln database: coniferopsida.fasta
Fln subject: A9NSU0
Fln msg: your sequence is shorter than subject: 74 - 131
Fln protein:
L
Protein Length:
75
Fln nts:
T
Fln Alignment:
HA8LWWM01AKKZZ___SDGVIQKIIREDFTACTIISIAHRIPTVMDCDKVLVVDAGIAKEFDKPSKLLE-QPSLFGALVQEYATRSS
A9NSU0________________TDALLQKVIRHEFSNCTVITIAHRVPTVIDSDMVLTLSDGKLAEYDNPAKLMENKSSLFAKLVAEYWSNCS
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
