UniGene Name: sp_v3.0_unigene162723
Length: 176 nt
![]() |
---|
>sp_v3.0_unigene162723
C |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Calcium-dependent protein kinase (Fragment) n=1 Tax=Citrullus lanatus RepID=Q6I672_CITLA | - | - | 3.0e-21 | 84% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 89% |
Sma3 | Calcium-dependent protein kinase | - | - | 0.0 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Non-specific serine/threonine protein kinase. | EC:2.7.11.1 | - | 8.974e-32 | - |
Sma3 | Calcium/calmodulin-dependent protein kinase. | EC:2.7.11.17 | - | 7.629e-22 | - |
Source | Gene names |
---|---|
Sma3 | 6J23.10; AK1; At1g18890; At1g76040; At2g35890; At2g38910; At2g41860; At3g10660; At3g57530; At4g23650; At5g04870; At5g12180; At5g12480; At5g19360; At5g19450; At5g23580; B0103C08-B0602B01.16; CDPK; CDPK1; CDPK12; CDPK19; CDPK1a; CDPK1a-2; CDPK1a-S2; CDPK1b; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
Sma3 | peroxisomal membrane | GO:0005778 | Cellular Component | 0.0 | - |
Sma3 | endoplasmic reticulum membrane | GO:0005789 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | calcium-dependent protein kinase C activity | GO:0004698 | Molecular Function | 0.0 | - |
Sma3 | calcium ion binding | GO:0005509 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
Sma3 | abscisic acid mediated signaling pathway | GO:0009738 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | Calcium-binding EF-hand | IPR002048 | - | 0.0 | - |
Sma3 | Serine/threonine- / dual-specificity protein kinase, catalytic domain | IPR002290 | - | 0.0 | - |
Sma3 | Parvalbumin | IPR008080 | - | 0.0 | - |
Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
Sma3 | EF-hand-like domain | IPR011992 | - | 0.0 | - |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Sma3 | IPR017442 | - | 0.0 | - | |
Sma3 | EF-Hand 1, calcium-binding site | IPR018247 | - | 0.0 | - |
Sma3 | EF-hand | IPR018248 | - | 0.0 | - |
Sma3 | EF-HAND 2 | IPR018249 | - | 0.0 | - |
Sma3 | ATPase, P-type phosphorylation site | IPR018303 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G19360.1 | CPK34 calcium-dependent protein kinase 34 chr5:6521716-6523780 REVERSE LENGTH=523 | 2.0e-27 | 82% |
RefSeq | Arabidopsis thaliana | NP_197437.1 | calcium-dependent protein kinase 34 [Arabidopsis thaliana] | 3.0e-27 | 82% |
RefSeq | Populus trichocarpa | XP_002299975.1 | calcium dependent protein kinase 17 [Populus trichocarpa] | 1.0e-25 | 77% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5AB63
Fln msg: Distance to subject end: 28 aas, your sequence is shorter than subject: 58 - 256
Fln protein:
I
Protein Length:
59
Fln nts:
C
Fln Alignment:
HA8LWWM01EL8DC___YSEMAAASIFRTIVQVVHTCHSMGVLHRDLKPENFLFLSEDEDSPLKAIDFGLSVFY
D5AB63________________YSERAAASLFRTIVKVVHTCHSMGVLHRDLKPENFLFVSKDEDSPLKAIDFGLSVFF
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain