UniGene Name: sp_v3.0_unigene162266
Length: 236 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene162266
G |
Ace file of the UniGene sp_v3.0_unigene162266 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | putative protein phosphatase 2C [Arabidopsis thaliana] | - | - | 7.0e-18 | 63% |
| FL-Next | sp=Protein phosphatase 2C and cyclic nucleotide-binding/kinase domain-containing protein; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 63% |
| Source | Gene names |
|---|---|
| Sma3 | At2g20050; GSVIVT00016693001; OSJNBa0063E14.1-1; Os02g0281000; OsI_06757; OsJ_06259; P0669G10.18-1; PHYPADRAFT_185240; PHYPADRAFT_185987; POPTRDRAFT_910927; RCOM_1050860; T2G17.15; VITISV_000895; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | cAMP-dependent protein kinase complex | GO:0005952 | Cellular Component | 0.0 | - |
| Sma3 | protein serine/threonine phosphatase complex | GO:0008287 | Cellular Component | 0.0 | - |
| Sma3 | magnesium ion binding | GO:0000287 | Molecular Function | 0.0 | - |
| Sma3 | protein kinase activity | GO:0004672 | Molecular Function | 0.0 | - |
| Sma3 | protein serine/threonine phosphatase activity | GO:0004722 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | cAMP-dependent protein kinase regulator activity | GO:0008603 | Molecular Function | 0.0 | - |
| Sma3 | manganese ion binding | GO:0030145 | Molecular Function | 0.0 | - |
| Sma3 | regulation of protein phosphorylation | GO:0001932 | Biological Process | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | protein dephosphorylation | GO:0006470 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Protease inhibitor I4, serpin | IPR000215 | - | 0.0 | - |
| Sma3 | Protein phosphatase 2C, manganese/magnesium aspartate binding site | IPR000222 | - | 0.0 | - |
| Sma3 | Cyclic nucleotide-binding domain | IPR000595 | - | 0.0 | - |
| Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
| Sma3 | Protein phosphatase 2C-like | IPR001932 | - | 0.0 | - |
| Sma3 | cAMP/cGMP-dependent protein kinase | IPR002373 | - | 0.0 | - |
| Sma3 | IPR014045 | - | 0.0 | - | |
| Sma3 | RmlC-like jelly roll fold | IPR014710 | - | 0.0 | - |
| Sma3 | Protein phosphatase 2C | IPR015655 | - | 0.0 | - |
| Sma3 | IPR017442 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT2G20050.1 | " protein serine/threonine phosphatases;protein kinases;catalytics;cAMP-dependent protein kinase regulators;ATP binding;protein serine/threonine phosphatases chr2:8649779-8654193 REVERSE LENGTH=1094" | 9.0e-23 | 63% |
| RefSeq | Arabidopsis thaliana | NP_001189557.1 | protein phosphatase 2C and cyclic nucleotide-binding/kinase domain-containing protein [Arabidopsis thaliana] | 1.0e-22 | 63% |
| RefSeq | Populus trichocarpa | XP_002324434.1 | predicted protein [Populus trichocarpa] | 3.0e-23 | 69% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q9SL76
Fln msg: Distance to subject end: 955 aas, your sequence is shorter than subject: 78 - 1094
Fln protein:
E
Protein Length:
79
Fln nts:
G
Fln Alignment:
HA8LWWM01BMZBW___SLDLDARVPRLSRLSAQFLPSSGSRVAQVPAFNFELKYSYLSQRGYYPESLDKANQDSFCIHMQFGNN
Q9SL76________________SRDQEWGITRLSRVSSQFLPPDGSRVVKVPSCNYELRCSFLSQRGYYPDALDKANQDSFAIHTPFGSN

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta (sense)