UniGene Name: sp_v3.0_unigene159964
Length: 186 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
![]() |
---|
>sp_v3.0_unigene159964
G |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Reverse transcriptase (Fragment) n=1 Tax=Pinus radiata RepID=Q56GF9_PINRA | - | - | 2.0e-24 | 86% |
FL-Next | sp=RNA-directed DNA polymerase homolog; berteroana). Mitochondrion. | - | - | 0.0 | 45% |
Sma3 | Gag-Pol polyprotein | - | - | 1.766e-12 | - |
Source | Gene names |
---|---|
Sma3 | 17.t00023; 20.t00045; AT4g04230; AT4g08100; AT4g10580; At2g04670; At2g06170; At2g06890; At2g07660; F5K24.9; F9D12.11; F9M13.15; H0211A12.9; LOC_Os03g35326; LOC_Os10g16560; LOC_Os10g20440; LOC_Os10g20960; LOC_Os10g21350; LOC_Os11g21960; LOC_Os11g23970; LOC |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | chromatin | GO:0000785 | Cellular Component | 0.0 | - |
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | chromatin binding | GO:0003682 | Molecular Function | 0.0 | - |
Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
Sma3 | carbonate dehydratase activity | GO:0004089 | Molecular Function | 0.0 | - |
Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
Sma3 | cysteine-type peptidase activity | GO:0008234 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
Sma3 | chromatin assembly or disassembly | GO:0006333 | Biological Process | 0.0 | - |
Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
Sma3 | carbon utilization | GO:0015976 | Biological Process | 0.0 | - |
![]() |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: P31843
Fln msg: Distance to subject end: 42 aas, your sequence is shorter than subject: 61 - 142
Fln protein:
A
Protein Length:
62
Fln nts:
G
Fln Alignment:
HA8LWWM01C2JLL___AKYFSKIDLKSRYHQVPIEPFNVWKNAFKAKEGLFKWLVMPFRLTNAPATFMRLMDEILW
P31843________________ATWFTKLDLRSGYWQVRIAKGDEPKTTCVTRYGSFEFRVMPFGLTNALATFCNLMNNVLY
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain