UniGene Name: sp_v3.0_unigene159105
Length: 222 nt
UniGene Fasta |
---|
>sp_v3.0_unigene159105
C |
Ace file of the UniGene sp_v3.0_unigene159105 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | 26S protease regulatory subunit 8 n=1 Tax=Ictalurus punctatus RepID=E3TEF6_ICTPU | - | - | 1.0e-22 | 72% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 90% |
Sma3 | Proteasomal ATPase | - | - | 4.741e-14 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Microtubule-severing ATPase. | EC:3.6.4.3 | - | 3.45e-16 | - |
Source | Gene names |
---|---|
Sma3 | AT4g29040; At1g09100; At1g45000; At1g45000/F27F5.8; At1g53750; At2g20140; At3g05530; At3g05530/F22F7.1; At4g29040; At5g19990; At5g20000; At5g43010; At5g58290; AtSUG1; BrTBP; CHLREDRAFT_184001; CHLREDRAFT_188404; CHLREDRAFT_24096; CHLREDRAFT_24536; CHLREDR |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | nucleolus | GO:0005730 | Cellular Component | 0.0 | - |
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | cytosol | GO:0005829 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | protein complex | GO:0043234 | Cellular Component | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | peptidase activity | GO:0008233 | Molecular Function | 0.0 | - |
Sma3 | nucleoside-triphosphatase activity | GO:0017111 | Molecular Function | 0.0 | - |
Sma3 | protein catabolic process | GO:0030163 | Biological Process | 0.0 | - |
Sma3 | cell division | GO:0051301 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | CDC48, N-terminal subdomain | IPR003338 | - | 0.0 | - |
Sma3 | AAA+ ATPase domain | IPR003593 | - | 0.0 | - |
Sma3 | ATPase, AAA-type, core | IPR003959 | - | 0.0 | - |
Sma3 | ATPase, AAA-type, conserved site | IPR003960 | - | 0.0 | - |
Sma3 | CDC48, domain 2 | IPR004201 | - | 0.0 | - |
Sma3 | 26S proteasome subunit P45 | IPR005937 | - | 0.0 | - |
Sma3 | ATPase, AAA-type, CDC48 | IPR005938 | - | 0.0 | - |
Sma3 | Aspartate decarboxylase-like fold | IPR009010 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G20000.1 | AAA-type ATPase family protein chr5:6756915-6759550 FORWARD LENGTH=419 | 2.0e-28 | 90% |
RefSeq | Arabidopsis thaliana | NP_197500.1 | AAA-type ATPase family protein [Arabidopsis thaliana] | 2.0e-28 | 90% |
RefSeq | Populus trichocarpa | XP_002311569.1 | predicted protein [Populus trichocarpa] | 2.0e-28 | 90% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LQW3
Fln msg: Distance to subject end: 190 aas, your sequence is shorter than subject: 74 - 288
Fln protein:
P
Protein Length:
75
Fln nts:
C
Fln Alignment:
HLKU4M004IKTCZ___PDSTYEMVGGLDXXXXXXXXXXXXXXXXXXLFEALGIAQPKGVILYGPPGTGKTLLARAVAHHTECTFIRVSGS
B8LQW3________________PDSTYDMIGGLDQQIKEIKEVIELPIKHPELFESLGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGS
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain