UniGene Name: sp_v3.0_unigene159100
Length: 169 nt
![]() |
---|
>sp_v3.0_unigene159100
C |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Kinesin-II motor protein n=1 Tax=Volvox carteri f. nagariensis RepID=D8UD54_VOLCA | - | - | 8.0e-22 | 90% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 48% |
Sma3 | Kinesin-like protein | - | - | 2.989e-19 | - |
Source | Gene names |
---|---|
Sma3 | At2g28620; At2g36200; At2g37420; At3g44050; At3g45850; At3g50240; At5g47820; B1066G12.23; CHLREDRAFT_114085; CHLREDRAFT_126081; CHLREDRAFT_13743; CHLREDRAFT_137882; CHLREDRAFT_150766; CHLREDRAFT_175469; CHLREDRAFT_180630; CHLREDRAFT_185750; CHLREDRAFT_995 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | microtubule | GO:0005874 | Cellular Component | 0.0 | - |
Sma3 | microtubule associated complex | GO:0005875 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | microtubule motor activity | GO:0003777 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | microtubule-based movement | GO:0007018 | Biological Process | 0.0 | - |
Sma3 | cellulose microfibril organization | GO:0010215 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | FERM domain | IPR000299 | - | 0.0 | - |
Sma3 | MyTH4 domain | IPR000857 | - | 0.0 | - |
Sma3 | Calponin homology domain | IPR001715 | - | 0.0 | - |
Sma3 | Kinesin, motor domain | IPR001752 | - | 0.0 | - |
Sma3 | Pentatricopeptide repeat | IPR002885 | - | 0.0 | - |
Sma3 | Kinesin-related conserved domain | IPR010544 | - | 0.0 | - |
Sma3 | FERM/acyl-CoA-binding protein, 3-helical bundle | IPR014352 | - | 0.0 | - |
Sma3 | FERM central domain | IPR019748 | - | 0.0 | - |
Sma3 | Band 4.1 domain | IPR019749 | - | 0.0 | - |
Sma3 | WD40 repeat, conserved site | IPR019775 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G50240.1 | KICP-02 ATP binding microtubule motor family protein chr3:18623380-18628784 REVERSE LENGTH=1051 | 1.0e-18 | 77% |
RefSeq | Arabidopsis thaliana | NP_566931.1 | ATP binding microtubule motor family protein [Arabidopsis thaliana] | 1.0e-18 | 77% |
RefSeq | Populus trichocarpa | XP_002310712.1 | predicted protein [Populus trichocarpa] | 9.0e-19 | 72% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5ACB2
Fln msg: Distance to subject end: 286 aas, your sequence is shorter than subject: 55 - 509
Fln protein:
L
Protein Length:
56
Fln nts:
C
Fln Alignment:
HLKU4M004H29U5___VDAKSQHIPYRDSKLTRLLQDSLGGNTKTVMVANIGPADWNFDETLSTLRYAHR
D5ACB2________________LDNDQIHIPFRGSKLTEVLRDSFVGNSRTVMISCVSPNSGSCEHTLNTLRYADR
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain