UniGene Name: sp_v3.0_unigene158952
Length: 178 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense) |
---|
>sp_v3.0_unigene158952
A |
Ace file of the UniGene sp_v3.0_unigene158952 (antisense) |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Aldehyde dehydrogenase protein 2, partially confirmed by transcript evidence (Fragment) n=2 Tax=Caenorhabditis elegans RepID=Q9TXM0_CAEEL | - | - | 4.0e-16 | 71% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 62% |
Sma3 | Aldehyde dehydrogenase | - | - | 3.034e-19 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Aldehyde dehydrogenase (NAD(+)). | EC:1.2.1.3 | - | 1.435e-06 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Glycolysis / Gluconeogenesis | 00010 | 1.435e-06 | % | |
Sma3 | Pentose and glucuronate interconversions | 00040 | 1.435e-06 | % | |
Sma3 | Ascorbate and aldarate metabolism | 00053 | 1.435e-06 | % | |
Sma3 | Fatty acid metabolism | 00071 | 1.435e-06 | % | |
Sma3 | Valine, leucine and isoleucine degradation | 00280 | 1.435e-06 | % | |
Sma3 | Lysine degradation | 00310 | 1.435e-06 | % | |
Sma3 | Arginine and proline metabolism | 00330 | 1.435e-06 | % | |
Sma3 | Histidine metabolism | 00340 | 1.435e-06 | % | |
Sma3 | Tryptophan metabolism | 00380 | 1.435e-06 | % | |
Sma3 | beta-Alanine metabolism | 00410 | 1.435e-06 | % | |
Sma3 | Glycerolipid metabolism | 00561 | 1.435e-06 | % | |
Sma3 | Pyruvate metabolism | 00620 | 1.435e-06 | % | |
Sma3 | Chloroalkane and chloroalkene degradation | 00625 | 1.435e-06 | % | |
Sma3 | Propanoate metabolism | 00640 | 1.435e-06 | % | |
Sma3 | Limonene and pinene degradation | 00903 | 1.435e-06 | % | |
Sma3 | Metabolic pathways | 01100 | 1.435e-06 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 1.435e-06 | % |
Source | Gene names |
---|---|
Sma3 | ALDH1a; ALDH2B; ALDH2a; ALDH2b; Aldh; Aldh 2A; Aldh2b; CHLREDRAFT_135609; GSVIVT00016121001; GSVIVT00030691001; OSJNBa0084K06.38; Os06g0270900; OsI_22484; OsJ_20928; PHYPADRAFT_155901; POPTRDRAFT_666446; RCOM_1511330; VITISV_013710; aldh; rf2; rf2a; rf2b; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | aldehyde dehydrogenase (NAD) activity | GO:0004029 | Molecular Function | 0.0 | - |
Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Aldehyde dehydrogenase domain | IPR015590 | - | 0.0 | - |
Sma3 | Aldehyde dehydrogenase, conserved site | IPR016160 | - | 0.0 | - |
Sma3 | Aldehyde dehydrogenase, N-terminal | IPR016162 | - | 0.0 | - |
Sma3 | Aldehyde dehydrogenase, C-terminal | IPR016163 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G23800.1 | ALDH2B7, ALDH2B aldehyde dehydrogenase 2B7 chr1:8412238-8414804 REVERSE LENGTH=534 | 2.0e-16 | 60% |
RefSeq | Arabidopsis thaliana | NP_564204.1 | aldehyde dehydrogenase 2B7 [Arabidopsis thaliana] | 2.0e-16 | 60% |
RefSeq | Populus trichocarpa | XP_002335877.1 | predicted protein, partial [Populus trichocarpa] | 3.0e-17 | 60% |
Full-Lengther Next Prediction |
---|
Fln status: Putative C-terminus
Fln database: coniferopsida.fasta
Fln subject: A9NUF6
Fln msg: STOP codon was not found. Distance to subject end: 5 aas, your sequence is shorter than subject: 58 - 544
Fln protein:
K
Protein Length:
59
Fln nts:
A
Fln Alignment:
HLKU4M004I8E8G___AHYITNALRAGSVWVNCYLVTDNGLPFGGYKQSGLGREKGEYGLAAYTEVKAV
A9NUF6________________ANTLTRALRVGTVWVNCFDIFDAGIPFGGYKMSGTGREKGIYSLQNYLQVKAV
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain