|
||||||
|
UniGene Name: sp_v3.0_unigene158519
Length: 198 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene158519
T |
|
Ace file of the UniGene sp_v3.0_unigene158519
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Aconitase 2 n=1 Tax=Capsaspora owczarzaki ATCC 30864 RepID=E9C8Q7_9EUKA | - | - | 2.0e-22 | 73% |
| FL-Next | sp=Aconitate hydratase, mitochondrial; Gracilaria gracilis (Red alga). | - | - | 0.0 | 65% |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Aconitate hydratase. | EC:4.2.1.3 | - | 6.161e-08 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Citrate cycle (TCA cycle) | 00020 | 6.161e-08 | % | |
| Sma3 | Glyoxylate and dicarboxylate metabolism | 00630 | 6.161e-08 | % | |
| Sma3 | Carbon fixation pathways in prokaryotes | 00720 | 6.161e-08 | % | |
| Sma3 | Biosynthesis of phenylpropanoids | 01061 | 6.161e-08 | % | |
| Sma3 | Biosynthesis of terpenoids and steroids | 01062 | 6.161e-08 | % | |
| Sma3 | Biosynthesis of alkaloids derived from shikimate pathway | 01063 | 6.161e-08 | % | |
| Sma3 | Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid | 01064 | 6.161e-08 | % | |
| Sma3 | Biosynthesis of alkaloids derived from histidine and purine | 01065 | 6.161e-08 | % | |
| Sma3 | Biosynthesis of alkaloids derived from terpenoid and polyketide | 01066 | 6.161e-08 | % | |
| Sma3 | Biosynthesis of plant hormones | 01070 | 6.161e-08 | % | |
| Sma3 | Metabolic pathways | 01100 | 6.161e-08 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 6.161e-08 | % |
| Source | Gene names |
|---|---|
| Sma3 | ACH1; CHLREDRAFT_129025; MICPUCDRAFT_70903; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
| Sma3 | aconitate hydratase activity | GO:0003994 | Molecular Function | 0.0 | - |
| Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
| Sma3 | 4 iron, 4 sulfur cluster binding | GO:0051539 | Molecular Function | 0.0 | - |
| Sma3 | tricarboxylic acid cycle | GO:0006099 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Aconitase A/isopropylmalate dehydratase small subunit, swivel | IPR000573 | - | 0.0 | - |
| Sma3 | Aconitase/3-isopropylmalate dehydratase large subunit, alpha/beta/alpha | IPR001030 | - | 0.0 | - |
| Sma3 | Aconitase, mitochondrial-like | IPR006248 | - | 0.0 | - |
| Sma3 | Aconitase/3-isopropylmalate dehydratase, swivel | IPR015928 | - | 0.0 | - |
| Sma3 | Aconitase/3-isopropylmalate dehydratase large subunit, alpha/beta/alpha, subdomain 1/3 | IPR015931 | - | 0.0 | - |
| Sma3 | Aconitase/3-isopropylmalate dehydratase large subunit, alpha/beta/alpha, subdomain 2 | IPR015932 | - | 0.0 | - |
| Sma3 | Aconitase/isopropylmalate dehydratase | IPR015937 | - | 0.0 | - |
| Sma3 | Aconitase family, 4Fe-4S cluster binding site | IPR018136 | - | 0.0 | - |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: P49609
Fln msg: Distance to subject end: 182 aas, your sequence is shorter than subject: 66 - 779
Fln protein:
S
Protein Length:
67
Fln nts:
T
Fln Alignment:
HLKU4M004J1HPX___GFDAGEDTYQAPPENSSHLSVKVDPKSSRLQLLEPFNAWDGKDLLNAPILIKARGKCTTDHIS
P49609________________GFDPGEDTFQPPSDDSTSILVQIDPDSQRLSFLEPFPAWDGKDYTDMPVLIKARGKCTTDHIS
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
