UniGene Name: sp_v3.0_unigene158468
Length: 177 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene158468
T |
Ace file of the UniGene sp_v3.0_unigene158468
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Rho GTPase n=2 Tax=Dictyosteliida RepID=D3B2K1_POLPA | - | - | 8.0e-25 | 89% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 71% |
| Sma3 | Putative rac protein | - | - | 1.872e-17 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Sphingomyelin phosphodiesterase. | EC:3.1.4.12 | - | 5.058e-09 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Sphingolipid metabolism | 00600 | 5.058e-09 | % | |
| Sma3 | Metabolic pathways | 01100 | 5.058e-09 | % |
| Source | Gene names |
|---|---|
| Sma3 | ARAC1; ARAC10; ARAC11; ARAC2; ARAC3; ARAC4; ARAC5; ARAC6; ARAC7; ARAC8; ARAC9; ATGP2; ATGP3; At1g20090; At2g17800; At2g44690; At3g48040; At4g28950; At4g35020; At5g45970; At5g62880; F16B22.18; F25O24.70; GSVIVT00003019001; GSVIVT00014385001; GSVIVT00016143 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
| Sma3 | nucleolus | GO:0005730 | Cellular Component | 0.0 | - |
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | spindle | GO:0005819 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | phragmoplast | GO:0009524 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | site of polarized growth | GO:0030427 | Cellular Component | 0.0 | - |
| Sma3 | apical part of cell | GO:0045177 | Cellular Component | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | GTP binding | GO:0005525 | Molecular Function | 0.0 | - |
| Sma3 | small GTPase mediated signal transduction | GO:0007264 | Biological Process | 0.0 | - |
| Sma3 | negative regulation of abscisic acid mediated signaling pathway | GO:0009788 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Small GTPase superfamily | IPR001806 | - | 0.0 | - |
| Sma3 | Small GTPase superfamily, Rho type | IPR003578 | - | 0.0 | - |
| Sma3 | Small GTP-binding protein domain | IPR005225 | - | 0.0 | - |
| Sma3 | IPR013753 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT4G35020.1 | ARAC3, ROP6, RHO1PS, ATROP6, RAC3 RAC-like 3 chr4:16673176-16674540 FORWARD LENGTH=198 | 1.0e-27 | 72% |
| RefSeq | Arabidopsis thaliana | NP_001190917.1 | Rac-like GTP-binding protein ARAC3 [Arabidopsis thaliana] | 2.0e-27 | 72% |
| RefSeq | Populus trichocarpa | XP_002301960.1 | predicted protein [Populus trichocarpa] | 3.0e-27 | 71% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5AAU7
Fln msg: Distance to subject end: 47 aas, your sequence is shorter than subject: 59 - 126
Fln protein:
C
Protein Length:
60
Fln nts:
T
Fln Alignment:
HLKU4M004IPUVI___CLLISYTTNSFPGEYVPTVFDNYTANAIVEGNPVNLGLWDTAGSEEYDSLRPLSYPGTD
D5AAU7________________CMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWDTAGQEDYNRLRPLSYRGAD

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta