UniGene Name: sp_v3.0_unigene158243
Length: 232 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene158243
G |
Ace file of the UniGene sp_v3.0_unigene158243
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | HAM group protein n=1 Tax=Dictyostelium discoideum RepID=B0G130_DICDI | - | - | 1.0e-35 | 93% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 79% |
| Sma3 | Histone acetyltransferase | - | - | 5.949e-25 | - |
| Source | Gene names |
|---|---|
| Sma3 | 181-1d10; At5g09740; At5g64610; CHLREDRAFT_192045; CHLREDRAFT_99077; GSVIVT00015313001; HAC108; HAG4; HAG5; HAG901; HAG902; HAM1501; HAM1502; HAM3501; HAM3502; HAM3503; LOC_Os07g43360; MICPUCDRAFT_32053; MICPUCDRAFT_3400; MICPUCDRAFT_45330; MICPUN_106515; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | chromatin | GO:0000785 | Cellular Component | 0.0 | - |
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | chromatin binding | GO:0003682 | Molecular Function | 0.0 | - |
| Sma3 | GO:0004406 | Molecular Function | 0.0 | - | |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | transferase activity, transferring acyl groups other than amino-acyl groups | GO:0016747 | Molecular Function | 0.0 | - |
| Sma3 | chromatin assembly or disassembly | GO:0006333 | Biological Process | 0.0 | - |
| Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
| Sma3 | chromatin modification | GO:0016568 | Biological Process | 0.0 | - |
| Sma3 | GO:0045449 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Chromo domain/shadow | IPR000953 | - | 0.0 | - |
| Sma3 | Thiolase | IPR002155 | - | 0.0 | - |
| Sma3 | MOZ/SAS-like protein | IPR002717 | - | 0.0 | - |
| Sma3 | Zinc finger, C2H2 | IPR007087 | - | 0.0 | - |
| Sma3 | Winged helix-turn-helix transcription repressor DNA-binding | IPR011991 | - | 0.0 | - |
| Sma3 | Zinc finger, C2H2-like | IPR015880 | - | 0.0 | - |
| Sma3 | Acyl-CoA N-acyltransferase | IPR016181 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G64610.1 | HAM1 histone acetyltransferase of the MYST family 1 chr5:25828333-25830503 REVERSE LENGTH=445 | 5.0e-36 | 79% |
| RefSeq | Arabidopsis thaliana | NP_201266.1 | histone acetyltransferase MYST1 [Arabidopsis thaliana] | 7.0e-36 | 79% |
| RefSeq | Populus trichocarpa | XP_002301018.1 | histone acetyltransferase [Populus trichocarpa] | 3.0e-35 | 77% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NUX9
Fln msg: Distance to subject end: 151 aas, your sequence is shorter than subject: 77 - 458
Fln protein:
T
Protein Length:
78
Fln nts:
G
Fln Alignment:
HLKU4M004H8Y2R___LNRHKLKCDLRHPPGNEIYRQANLSMFEVDGKKNKIYCQNLCLLAKLFLDHKTLYYDVEPFLFYILTECDSR
A9NUX9________________LQRHMRKCDLKHPPGDEIYRSGTLSMFEVDGKKNKVYAQNLCYLAKLFLDHKTLYYDVDLFLFYILCECDDR

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta