|
||||||
|
UniGene Name: sp_v3.0_unigene158105
Length: 191 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene158105
C |
|
Ace file of the UniGene sp_v3.0_unigene158105
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | FKBP-type peptidyl-prolyl cis-trans isomerase (Fragment) n=1 Tax=Amblyomma variegatum RepID=F0J8S6_AMBVA | - | - | 3.0e-15 | 59% |
| FL-Next | sp=Peptidyl-prolyl cis-trans isomerase; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 60% |
| Sma3 | FK506-binding protein 2-1 | - | - | 3.127e-15 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Peptidylprolyl isomerase. | EC:5.2.1.8 | - | 1.655e-17 | - |
| Source | Gene names |
|---|---|
| Sma3 | AT5G48570; At3g25220; At3g25230; At5g48570; At5g48580; CHLREDRAFT_77543; FKB12; FKBP15; FKBP15-1; FKBP15-2; FKBP70; FKBP77; GSVIVT00011129001; GSVIVT00012382001; K15N18.5; MJL12.17; OJ1191_A10.119; OSJNBa0048K16.32; OSJNBa0091C07.4; OSJNBb0065C04.47; Os01 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
| Sma3 | endoplasmic reticulum | GO:0005783 | Cellular Component | 0.0 | - |
| Sma3 | endoplasmic reticulum lumen | GO:0005788 | Cellular Component | 0.0 | - |
| Sma3 | peptidyl-prolyl cis-trans isomerase activity | GO:0003755 | Molecular Function | 0.0 | - |
| Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
| Sma3 | calmodulin binding | GO:0005516 | Molecular Function | 0.0 | - |
| Sma3 | isomerase activity | GO:0016853 | Molecular Function | 0.0 | - |
| Sma3 | protein folding | GO:0006457 | Biological Process | 0.0 | - |
| Sma3 | response to stress | GO:0006950 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Peptidyl-prolyl cis-trans isomerase, FKBP-type, domain | IPR001179 | - | 0.0 | - |
| Sma3 | Tetratricopeptide TPR-1 | IPR001440 | - | 0.0 | - |
| Sma3 | Glycoside hydrolase, chitinase active site | IPR001579 | - | 0.0 | - |
| Sma3 | Tetratricopeptide-like helical | IPR011990 | - | 0.0 | - |
| Sma3 | Tetratricopeptide repeat-containing domain | IPR013026 | - | 0.0 | - |
| Sma3 | Tetratricopeptide repeat | IPR019734 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G48580.1 | FKBP15-2 FK506- and rapamycin-binding protein 15 kD-2 chr5:19696156-19697304 REVERSE LENGTH=163 | 2.0e-19 | 61% |
| RefSeq | Arabidopsis thaliana | NP_199669.1 | FK506-binding protein 2-2 [Arabidopsis thaliana] | 2.0e-19 | 61% |
| RefSeq | Populus trichocarpa | XP_002321107.1 | predicted protein [Populus trichocarpa] | 3.0e-19 | 61% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: E0Z6B9
Fln msg: Distance to subject end: 36 aas, your sequence is shorter than subject: 63 - 160
Fln protein:
F
Protein Length:
64
Fln nts:
C
Fln Alignment:
HLKU4M004JJ48U___VHYTGTLEDGTVFDCSRKRGTLFEFQVGMGGVIKGWDQGLLEFSLGERSNLRIPPNLAYG
E0Z6B9________________VHYRGSLTDGTVFDSSFERGDPIEFEIGSGQVIKGWDQGLLGMCVGEKRKLKIPSKLGYG
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
